KEGG   Burkholderia cenocepacia AU1054: Bcen_2574Help
Entry
Bcen_2574         CDS       T00363                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01130  Biosynthesis of antibiotics
bcn01230  Biosynthesis of amino acids
Module
bcn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcen_2574
Enzymes [BR:bcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Bcen_2574
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABF77473
JGI: Bcen2574
UniProt: Q1BSD2
Position
1:2831645..2832430
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEIAAALRSTPLEALKLEASARDLRDFVGALRAKHAAGNAAVIAEIK
KASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGGVRYLEEARAACTLPVLRK
DFIVDAYQIVEARAMGADAILLIAAALDTPLMQDLEAYAHSLGLAVLVEVHDRHEMEQAL
TLKTPLLGINNRNLRTFETSIQTTLDMLDMIPADRIVVTESGILSRTDVDTMRAANVNTF
LVGEAFMRAEQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgaatcatcgccgtcaagcgcgaagaaatcgcggcggccctg
cgcagcacgccgctcgaggcactgaaactggaagcctcggcgcgcgacctgcgcgacttc
gtcggcgcgctgcgcgcgaagcacgcggccggcaacgccgccgtgatcgccgaaatcaag
aaggccagcccgtcgaaaggcgtgctgcgcgagcatttcgtgccggccgacatcgcgcgc
tcgtatgcggcgcacggcgccgcgtgcctgtcggtgctgaccgacgagcagttcttccag
ggcggcgtccgctatctcgaggaagcgcgcgcggcctgcacgctgccggtgctgcgcaag
gacttcatcgtcgacgcgtaccagatcgtcgaagcccgcgcgatgggcgccgatgcgatc
ctgctgatcgccgccgcactcgacacgccgctgatgcaggatctcgaagcgtatgcgcac
tcgctcggcctcgcggtgctggtcgaagtgcacgaccgccacgagatggaacaggcgctg
acgctgaagacgccgctgctcggcatcaacaaccgcaacctgcgcacgttcgagacgtcg
atccagaccacgctcgacatgctcgacatgattccggcggatcgcatcgtcgtgaccgaa
tcgggcatcctgtcgcgcaccgacgtcgacacgatgcgcgcggcgaacgtgaacacgttc
ctcgtcggcgaggcgttcatgcgcgccgagcagccgggcgaggaactcgcacggatgttc
ttctga

DBGET integrated database retrieval system