KEGG   Burkholderia cenocepacia AU1054: Bcen_2579Help
Entry
Bcen_2579         CDS       T00363                                 

Definition
protein-disulfide isomerase-like
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Brite
Enzymes [BR:bcn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Bcen_2579
Secretion system [BR:bcn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bcen_2579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2836767..2837495)
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGNDAPIKSVSKSPVAGLYEV
NLGSQIIYSDAAGDYVLLGDLVDAKTHKNLTDARLSEINKIDFASLPFANAIKIVKGNGA
RKIAVFSDPNCPYCKKLETTLQSVDNVTVYTFLYPVLSPDSTAKSKAIWCATDRAKTWES
WMLDHRAPSGAGTCDTTALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
SK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgatccgcatcgcgtcgctggcgctggccgtcacgatggcgacgctcggc
tgcaccgcgcaggccgaccagaccaccgacaagctgaaggccacgctgcaagcccgtctc
ggcaacgacgcgccgatcaagagcgtgtcgaaatcgccggtcgcaggcctttacgaagtg
aacctcggctcgcagatcatctatagcgacgcggcgggcgactacgtgctgctcggcgat
ctcgtcgacgcgaagacgcacaagaacctgaccgacgcccgcctgtccgaaatcaacaag
atcgacttcgcgagcctgccgttcgcgaatgcgatcaagatcgtcaagggcaacggtgcc
cgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagaagctcgagacgacg
ctgcagtcggtcgacaacgtgaccgtctacacgttcctgtacccggtgctgtcgccggat
tcgaccgcgaagtcgaaggcgatctggtgcgcgaccgatcgcgcgaagacgtgggaaagc
tggatgctcgaccatcgcgcgccgtccggcgccggtacctgcgacaccaccgcgctcgac
aagaacctcgcgctcggccgcgggatgaacgtcacgggcacgccgacgatctttttgccg
gacggtcgccgcctgccgggcgcggtatcggccgaccagctcaaccaggcgctcgcctcg
agcaagtaa

DBGET integrated database retrieval system