KEGG   Burkholderia cenocepacia AU1054: Bcen_2991Help
Entry
Bcen_2991         CDS       T00363                                 

Definition
limonene-1,2-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:bcn00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
2:5622..6011
Genome map
AA seq 129 aa AA seqDB search
MTTDVLAVALRFFSLWTENRIDDALSMLSDDVLYDNVPFPDIVGRDNVRQFHGDFGIGTT
FKVDWTVTHIAAAGNVVLNERIDVFQHESGGKITLPVMGTLTIVDDRITVWRDYFDPADF
DRQLSAIKK
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgatgttttggccgtggcgcttcgattcttttcgctttggaccgaaaaccgc
atcgacgacgcgctgtcgatgctctccgatgatgtcctctacgacaacgttccgttcccc
gacatcgttggacgggacaatgttcgccaattccacggcgacttcgggatcggtacgacg
ttcaaggtcgactggacggtgacccatatcgccgcagcgggaaacgtcgtcctcaatgag
cggatcgacgtctttcaacacgaatcaggcggaaaaatcacgcttcccgtgatgggtacc
ctgaccatcgtcgatgatcgaatcacggtttggcgagactacttcgatcccgcggacttc
gatcggcagttgagtgcaatcaagaagtag

DBGET integrated database retrieval system