KEGG   Burkholderia cenocepacia AU1054: Bcen_3083Help
Entry
Bcen_3083         CDS       T00363                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bcn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
2:complement(113749..114813)
Genome map
AA seq 354 aa AA seqDB search
MFTSISSHSSFPAERVKLCARPRRMIRQPHIGRDDPMNDHTHFQPLGGNEMPRCGGIATM
MRLPHVSSAEGLDACFVGVPFDLGTSNRTGARFGPRQIRTESVLLRPYNMATRAAPFDSL
QIADIGDVAINPYNLHDSIARIEAAYDAILEHDCKPITLGGDHTIALPILRAIHRKHGKV
ALIHVDAHADVNDTMMGEKIAHGTPFRRAVEEGLLHGDKVTQIGLRGTGYAAEDFDWCRE
QGFRVVQAEECWNKSLAPLMEEVRARIGDTPVYITFDIDGIDPAYAPGTGTPEIAGLTVP
QALEIIRGAMGLNIVGCDLVEVAPPYDPFGTTALLGANLAYELLCVLPGVAYRD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtttacgtcgatatcttcgcattcttctttcccggcggagcgcgtaaaactgtgcgcc
aggccgcgtcgcatgatacggcaaccccacatcggaagagacgaccccatgaacgaccac
acccatttccagccgctcggcggcaatgaaatgccgcgctgcggcggcatcgcgacgatg
atgcgcctgccgcacgtgtcgagcgccgaaggcctcgacgcgtgtttcgtcggcgtgccg
ttcgatctcggcacctccaaccgcaccggcgcgcgcttcggcccgcgccagatccgtacc
gaatccgtgctgctgcgcccgtacaacatggccacgcgcgcagcacccttcgattcgctg
cagatcgccgacatcggcgacgtcgcgatcaatccgtacaacctgcacgattcgatcgcc
cgcatcgaggccgcgtacgacgcgattctcgagcacgactgcaagccgatcacgctcggc
ggcgaccatacgatcgcgctgccgatcctgcgcgcgatccaccgcaagcacggcaaggtt
gcattgatccacgtcgatgcacacgccgacgtgaacgacacgatgatgggcgaaaagatc
gcgcacggcacgccgttccgccgcgcggtcgaggaagggctgctgcacggcgacaaggtc
acgcagatcggcctgcgcggcaccggctacgcggccgaggatttcgactggtgccgcgag
cagggcttccgcgtggtccaggccgaggaatgctggaacaagtcgctcgcgccgctgatg
gaagaagtgcgcgctcgcatcggcgacacgcccgtctacatcacgttcgacatcgacggc
atcgatccggcctatgcgccgggcaccggcacgccggaaatcgcgggcctcacggtgccg
caggcgctcgagatcatccgcggcgcgatggggctgaacatcgtcggctgcgatctcgtc
gaagtcgcgccgccgtacgacccgttcggcaccacggcgctgctcggcgcgaacctcgcg
tacgagctgctgtgcgtgctgccgggcgtcgcgtaccgcgactga

DBGET integrated database retrieval system