KEGG   Burkholderia cenocepacia AU1054: Bcen_3278Help
Entry
Bcen_3278         CDS       T00363                                 

Definition
(GenBank) glutathione-independent formaldehyde dehydrogenase
  KO
K00148  glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00625  Chloroalkane and chloroalkene degradation
bcn00680  Methane metabolism
bcn01100  Metabolic pathways
bcn01120  Microbial metabolism in diverse environments
bcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Bcen_3278
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcen_3278
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.46  formaldehyde dehydrogenase
     Bcen_3278
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PALP FAD_binding_3 XdhC_C 2-Hacid_dh_C Glutaredoxin HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABF78173
JGI: Bcen3278
UniProt: A0A0H2XUJ5
Position
2:358537..359733
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGQVEVQKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKLGDLVSVPFNVACGRCAMCKDTHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHARAMGFETVDLSKD
ASLGEQIEQILGVPEIDCAVDCVGFEAHGHGSSGHSEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILFDRLPIA
KIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttgggccgggccaggtcgaagtccagaaaatc
gattatccgaagatggtcgacccaagcggccgcgcgatcggccacggcgtgatcctgaaa
gtggtcagcacgaacatctgcggctccgaccagcacatggtgcgcggccgtacgaccgcg
ccggtcggcctcgtgctcggtcacgagatcaccggcgaagtggtcgaggtgggccgcgac
gtcgagacgctgaagctcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggacacgcacaccggcgtgtgcctgaacgtgaacccgtcgcgtgcc
ggcggcgcgtacggctacgtcgacatgggcggctggatcggcggccaggccgagtacgtg
ctcgtgccgtatgccgatttcaacctgctgaaattcccggatcgcgatcaggcgatggcg
aagatccgcgacctgacctgcctgtccgacatcctgccgaccggttatcacggcgcggtg
agcgcgggcgtgaagcccggttcgacggtctatatcgcgggcgcgggcccggtcgggatg
gcggcggccgcgtcggcgcgcctgctcggcgcggccgtgacgatcgtcggcgacatgaac
gcggaacgcctcgcgcatgcgcgggcgatggggttcgagacggtcgacctgtcgaaggac
gcgtcgctcggcgagcagatcgagcagatcctcggtgtgcccgagatcgattgcgcggtc
gactgcgtcggcttcgaggcgcacggtcacggctcgtcgggccattcggaggaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcgcccggccggcgcgatcggcatcccg
ggcctgtacgtgacggacgatccgggtgcgaaggacaaggccgcgcagcacggcagcctg
agcatccgcttcggcctcggctgggcgaagtcgcattcgttcttcacgggccagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
aagatcgtcaacgtcgaagtgatctcgctcgaccaggcgccggaaggctacaagaagttc
gacggcggtgcgccgcgcaaattcgtcatcgacccgcacgggttgctggcggcgtga

DBGET integrated database retrieval system