KEGG   Burkholderia cenocepacia AU1054: Bcen_3278Help
Entry
Bcen_3278         CDS       T00363                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K00148  
glutathione-independent formaldehyde dehydrogenase [EC:1.2.1.46]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Chloroalkane and chloroalkene degradation
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bcn01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:bcn00680]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bcn00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
2:358537..359733
Genome map
AA seq 398 aa AA seqDB search
MSSNRGVVYLGPGQVEVQKIDYPKMVDPSGRAIGHGVILKVVSTNICGSDQHMVRGRTTA
PVGLVLGHEITGEVVEVGRDVETLKLGDLVSVPFNVACGRCAMCKDTHTGVCLNVNPSRA
GGAYGYVDMGGWIGGQAEYVLVPYADFNLLKFPDRDQAMAKIRDLTCLSDILPTGYHGAV
SAGVKPGSTVYIAGAGPVGMAAAASARLLGAAVTIVGDMNAERLAHARAMGFETVDLSKD
ASLGEQIEQILGVPEIDCAVDCVGFEAHGHGSSGHSEEAPATVLNSLMEITRPAGAIGIP
GLYVTDDPGAKDKAAQHGSLSIRFGLGWAKSHSFFTGQTPVLKYNRNLMQAILFDRLPIA
KIVNVEVISLDQAPEGYKKFDGGAPRKFVIDPHGLLAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgagcagcaatcgaggtgtcgtctatcttgggccgggccaggtcgaagtccagaaaatc
gattatccgaagatggtcgacccaagcggccgcgcgatcggccacggcgtgatcctgaaa
gtggtcagcacgaacatctgcggctccgaccagcacatggtgcgcggccgtacgaccgcg
ccggtcggcctcgtgctcggtcacgagatcaccggcgaagtggtcgaggtgggccgcgac
gtcgagacgctgaagctcggcgatctcgtgtcggtgccgttcaacgtcgcgtgcggccgc
tgcgcgatgtgcaaggacacgcacaccggcgtgtgcctgaacgtgaacccgtcgcgtgcc
ggcggcgcgtacggctacgtcgacatgggcggctggatcggcggccaggccgagtacgtg
ctcgtgccgtatgccgatttcaacctgctgaaattcccggatcgcgatcaggcgatggcg
aagatccgcgacctgacctgcctgtccgacatcctgccgaccggttatcacggcgcggtg
agcgcgggcgtgaagcccggttcgacggtctatatcgcgggcgcgggcccggtcgggatg
gcggcggccgcgtcggcgcgcctgctcggcgcggccgtgacgatcgtcggcgacatgaac
gcggaacgcctcgcgcatgcgcgggcgatggggttcgagacggtcgacctgtcgaaggac
gcgtcgctcggcgagcagatcgagcagatcctcggtgtgcccgagatcgattgcgcggtc
gactgcgtcggcttcgaggcgcacggtcacggctcgtcgggccattcggaggaagcgccc
gcgacggtgctgaactcgctgatggaaatcacgcgcccggccggcgcgatcggcatcccg
ggcctgtacgtgacggacgatccgggtgcgaaggacaaggccgcgcagcacggcagcctg
agcatccgcttcggcctcggctgggcgaagtcgcattcgttcttcacgggccagacgccg
gtgctgaagtacaaccgcaacctgatgcaggcgatcctgttcgaccggctgccgatcgcg
aagatcgtcaacgtcgaagtgatctcgctcgaccaggcgccggaaggctacaagaagttc
gacggcggtgcgccgcgcaaattcgtcatcgacccgcacgggttgctggcggcgtga

DBGET integrated database retrieval system