KEGG   Burkholderia cenocepacia AU1054: Bcen_3921Help
Entry
Bcen_3921         CDS       T00363                                 

Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bcn01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bcn00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
2:1077802..1079385
Genome map
AA seq 527 aa AA seqDB search
MSQYQDDIKAVAGLKENHGSAWNAISPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPSKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDATAKAAIQQKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNQPGDLGDQYNAFLDCEELSADQLGNGD
VVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHIAQIGG
MVSEIRKVIPNAKLVYNNSPSFNWTLNFRQQAYDAMKAEGKDVSAYDRAQLMSVEYDETE
LAKLADEKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQF
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatatcaagacgacatcaaggcagtggctggcttgaaggaaaaccacggcagc
gcgtggaacgccatcagccccgagtatgcggcccgcatgcgtgcccagaacaagttcaag
accggcctggacatcgcgaagtacaccgcgaagatcatgcgcgccgacatggccgcgtac
gatgccgatccgtccaagtacacgcagtcgctgggttgctggcacggcttcatcggccag
cagaagatgatttccatcaagaagcacttcaacagcaccgaacgtcgctacctgtacctg
tcgggctggatggtcgccgcgctgcgttcggaattcggcccgctgccggaccagtcgatg
cacgaaaagacctcggtcagcgcgctgatccgcgagctgtacacgttcctgcgccaggct
gacgcccgtgagctgggcggcctgttccgcgagctggatgccgcgaaggacgcgaccgcc
aaggccgcgatccagcaaaagatcgacaaccacgtcacgcacgtcgtgccgatcatcgcc
gacatcgacgccggcttcggcaacgcggaagcgacctacctgctggccaagcagttcatc
gaagcgggcgcgtgctgcatccagatcgaaaaccaggtgtcggacgagaagcagtgcggc
caccaggacggcaaggtcacggtgccgcacgaggacttcctcgcgaagatccgcgcgatc
cgctacgcattcctggagctgggcgtggacgacggcatcatcgtcgcccgtaccgattcg
ctgggcgctggcctgaccaagcagatcgccgtgacgaaccagccgggcgacctgggcgat
caatacaacgcgttcctcgattgcgaagaactgtcggccgaccaactgggcaacggtgac
gtcgtcatcaagcgcgacggcaagctgctgcgcccgaagcgcctgccgagcaacctgttc
cagttccgcgccggcacgggcgaagcgcgttgcgtgctcgactgcatcacgtcgctgcag
aacggcgccgacctgctgtggatcgaaaccgaaaaaccgcatatcgcacagatcggcggc
atggtcagcgagatccgcaaggtgatcccgaacgcgaagctggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgccagcaggcgtacgacgcgatgaaggccgaaggc
aaggacgtgtcggcttacgaccgtgcgcagctgatgagcgtcgaatacgacgaaaccgaa
ctggccaagctcgccgacgagaagatccgtacgttccaggccgatgcatcgcgtgaagca
ggcatcttccaccacctgatcacgctgccgacgtaccacacggcagcgctgtcgaccgac
aacctggccaaggaatacttcggcgaccagggcatgctcggctacgtggcaggcgtgcag
cgcaaggaaatccgccagggcatcgcgtgcgtgaagcaccagaacatgtcgggttcggac
atcggcgacgaccacaaggaatacttcagcggcgaagcggcgctgaaggcagcgggcaag
gacaacacgatgaatcagttctga

DBGET integrated database retrieval system