KEGG   Burkholderia cenocepacia AU1054: Bcen_3928Help
Entry
Bcen_3928         CDS       T00363                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcen_3928
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_3928
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen_3928
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcen_3928
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcen_3928
   00626 Naphthalene degradation
    Bcen_3928
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcen_3928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
2:1092849..1093877
Genome map
AA seq 342 aa AA seqDB search
MTQTMKAAVVHAFGEPLRIEEVPIPAPGPGQILVNIKASGVCHTDLHAADGDWPVKPSLP
FIPGHEGVGIVAAVGAGVTHVREGDRVGVPWLYTACGHCEYCCTGWETLCHGQQNTGYSV
NGSYAEYVLADPDYVGQLPAQVAFDEIAPILCAGVTVYKGIRVTDTRPGQWLAISGIGGL
GHVAVQYARAMGLHVAAIDISPDKLALARQLGAHLTIDASIDDPAKVIQKEIGGAHGVLV
TAVSRSAFAQALGMVRRGGTVALNGLPPGDFPLPIFSTVLNGITVRGSIVGTRRDLQESL
DFAADGLVRAHIHRDRLGNINDIFAKLREGKVDGRIVLTDMH
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgacccagaccatgaaagcggccgtggtacacgcgttcggcgagccgttgcgcatcgag
gaagtcccgatccccgcaccggggcccggccagattctcgtcaacatcaaggcgtcgggt
gtctgccataccgatctgcacgcggccgacggcgactggcccgtcaagccgtcgctgccg
ttcatcccgggccacgaaggcgtggggatcgtcgcggcggtcggcgcgggcgtcacgcac
gtgcgcgagggcgatcgcgtcggcgtgccgtggctctatacggcctgcggccattgcgag
tactgctgcacgggctgggaaacgctgtgccatgggcagcagaacaccggttattcggtg
aacggcagctacgcggaatacgtgctggccgatcccgattacgtcggccagttgcccgcg
caggtggcgttcgacgagatcgcgccgatcctgtgcgcgggtgtcacggtctacaagggc
attcgggtcaccgacacgcgcccgggccagtggctcgcgatttccggcatcggcggcctc
gggcacgtggccgtgcagtatgcgcgtgcgatgggcctgcacgtcgcggccatcgacatt
tctcccgacaagctcgcgctggcgcggcaactgggcgcccatctgacgatcgatgcgtcg
atcgacgaccccgcgaaagtgatccagaaggaaatcggcggcgcgcacggcgtgctcgtc
acggcggtatcgcgcagcgcgttcgcgcaggcgctcgggatggtccggcgcggcggcacg
gtggcgctcaatggtttgccgccgggcgatttcccgctgccgatcttctcgaccgtgctg
aacggcatcaccgtgcgcgggtcgatcgtcggcacgcggcgcgatctgcaggaatcgctc
gatttcgcggcggacggcctggtgcgcgcgcatatccaccgcgaccggctcggcaacatc
aacgacatcttcgcgaagctgcgggaagggaaggtcgacgggcgcatcgtgctgaccgac
atgcattga

DBGET integrated database retrieval system