KEGG   Burkholderia cenocepacia AU1054: Bcen_4022Help
Entry
Bcen_4022         CDS       T00363                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bcn  Burkholderia cenocepacia AU1054
Brite
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bcen_4022
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
2:1191425..1192846
Genome map
AA seq 473 aa AA seqDB search
MTARPAFPSPDAAGTPAPRAPSRLLRRVAFVLGAAVIGYGAFAIAFPAQVPAAIGTVVAD
WTGANPHPVVLQRPAAQPLSAVAQLGRALFHDPSLSASGKQSCASCHSPDHAYGPPNALD
VQPGGLAMTQQGYRPPPSLMYLYRQPNFSIGPDAGENDAAPSVAQQATAAAGVVKAQKVA
GTSAAPQLVPQGGMFWDGRADTLQQQAFGPLLNPVEMANASVDDVARKLAQSSHRAQFEQ
LFGARVFSTPQLAVSEAMFAIARYQVEDPSFHPYDSKYDRWLEGRARLTQAELRGLRLFN
DPDKANCAGCHLSKPGKDGLPPMFTDYQYEALGAPRNRALAQNRNPAFYDLGVCGPFRDD
LKDQTQYCGMFLTPTLRNSATRHVFFHNGVFHTLDQVMAFYNERSISPQKFYSRGADGKV
DEYDDIPPKYRANVDVTDAPFDRKPGDKPAMTAQDIKDIEAFLGTLTDAPAQH
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgacagctcgccccgcctttccgtcccccgacgccgccggcacgcccgcgccgcgcgcc
ccttcccgcctgctgcgccgcgtggcgttcgtgctaggcgcggccgtgatcggctatggc
gcgttcgcgatcgcgtttcccgcccaggtgccggcggcgatcggcaccgtggtcgccgac
tggaccggcgcgaatccgcatccggtcgtgctgcagcggcccgccgcgcagccgctgtcg
gcggtcgcgcagctcgggcgcgcgctgttccacgatccgtcgctgtccgcatcgggcaag
cagtcgtgcgcgtcgtgccatagtcccgatcatgcgtatggcccaccgaatgcgctcgac
gtgcaaccgggcggcctcgcgatgacgcagcagggctatcgtccgccgccgtcgctgatg
tacctgtaccgccagccgaatttcagcatcggccccgacgccggtgaaaacgacgccgcg
ccgagcgtcgcgcagcaggccacggcggcggccggcgtcgtcaaggcgcagaaggtggcc
ggtacgtcggccgcgccgcagctcgtgccgcaaggcgggatgttctgggacggccgcgcc
gatacgctgcagcaacaggcgttcggcccgctgctgaatccggtcgagatggcgaatgcg
agcgtcgacgacgtcgcacgcaagctcgcgcagtcgtcgcatcgcgcgcaattcgagcag
ttgttcggcgcgcgcgtgttctccacgccgcagctcgcggtgtcggaagcgatgttcgcg
atcgcgcgctatcaggtcgaggatccgtcgttccatccgtacgacagcaagtacgaccgc
tggctcgaaggccgcgcgcgcctcacgcaggccgaactgcgcgggctgcgcctgttcaac
gatccggacaaggcgaattgcgcgggctgccacttgtcgaaacccggcaaggacggcttg
ccgccgatgtttaccgattaccagtacgaggcgctcggcgcgccgcgcaaccgggcgctc
gcgcagaaccgcaacccggcgttctacgatctcggcgtgtgcgggccgttccgcgacgac
ctgaaggaccagacacagtattgcgggatgttcctgacgccgacgctgcgtaattcggcg
acacgccacgtgttcttccacaacggcgtattccacacgctcgaccaggtgatggcgttc
tacaacgagcgcagcatctcgccgcagaagttctattcgcgcggcgcggacggcaaggtc
gacgaatacgacgacattccgccgaaatatcgcgcgaacgtcgacgtgaccgatgcgccg
ttcgatcgcaagccgggcgacaaacccgcgatgacggcgcaggacatcaaggatatcgaa
gcgttcctcggcacgctgacggacgccccggcgcagcactga

  All links  
No link information was found.   
DBGET integrated database retrieval system