KEGG   Burkholderia cenocepacia AU1054: Bcen_4360Help
Entry
Bcen_4360         CDS       T00363                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Bcen_4360
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_4360
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen_4360
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcen_4360
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcen_4360
   00626 Naphthalene degradation
    Bcen_4360
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcen_4360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1586491..1587648)
Genome map
AA seq 385 aa AA seqDB search
MNPFQFRTVPTQIVEFGAARRLGALLRERFPALVRLCVVTDAFLHRSGVLAPALESLAAH
GWQVTVIDDVIADPPEHVVLEATARAVAADAEIVLGLGGGSSMDVAKLIAVLAPGQQALA
DMYGVDKVASARLPLVQMPTTAGTGSEVTAVSIVTVGEARKMGVVSPHLFADVAILDAEL
TLGLPRAATAATGIDAMVHAIEAYTSARLKNPVSDMLATHALTLLSRNLLPACDDGRNRH
AREAMLVGAMFAGQAFANAPVAAVHALAYPVGGIFHVPHGLSNALVLPHVLRFNAPAAAP
LYAELAAIAAPSATGSDEAKTHALIAEIDRLIVATGIPRTLREVGIGEADLPRMASDAML
QTRLLVNNPREVTEADALEIYRQAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtttcaattccgtaccgttccgacccagatcgtcgaattcggcgccgcgcgc
cggctcggcgcgctgttgcgcgaacgctttccggcgctcgtgcggctgtgcgtcgtcacc
gatgcgttcctgcatcgcagcggcgtgctcgcgcccgcgctggagagcctcgccgcgcat
ggctggcaggtcaccgtgatcgacgacgtgatcgccgatccgcccgagcacgtggtgctc
gaagccaccgcgcgggccgtcgcggccgatgccgagatcgtgctcgggctcggcggcggc
tcgtcgatggacgtcgcgaagctgatcgcggtgctcgcgccggggcagcaggcgctggcc
gacatgtacggcgtcgacaaggtcgcgagcgcgcggctgccgctcgtgcagatgccgacc
acggccggcacgggctccgaggtcacggccgtgtcgatcgtcacggtcggcgaggcgcgc
aagatgggggtcgtgtcgccgcatctgttcgcggacgtcgcgatcctcgacgcggaactc
acgctcggcctgccgcgcgcggcgacggccgccaccggcatcgacgcgatggtgcatgcg
atcgaggcgtacacgtccgcgcggctgaagaatccggtgtccgacatgctggccacgcac
gcgctgacgctgctgtcgcgcaacctgctgcccgcctgcgacgacggccggaaccggcac
gcgcgcgaagcgatgctggtcggcgcgatgttcgcggggcaggcgttcgcgaatgcgccg
gtcgcggccgtgcacgcgctggcttatcccgtgggcgggatcttccatgtgccgcacggg
ctgtcgaatgcgctggtgctgccgcacgtgctgcgcttcaatgcgccggccgccgcgccg
ctgtatgcggaactggcggccatcgccgcgccgtcggccacgggcagcgacgaagcgaaa
acgcacgcgctgatcgccgagatcgaccggctgatcgtcgcgacgggcattccgcgcacg
ttgcgggaggtcggtatcggcgaggccgacctgccgaggatggcgtcggacgcaatgctg
cagacgcgcctgctcgtgaacaatccgcgcgaggtgaccgaggccgacgcgctggagatt
taccggcaggcgtggtga

DBGET integrated database retrieval system