KEGG   Burkholderia cenocepacia AU1054: Bcen_4360Help
Entry
Bcen_4360         CDS       T00363                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00010  Glycolysis / Gluconeogenesis
bcn00071  Fatty acid degradation
bcn00350  Tyrosine metabolism
bcn00625  Chloroalkane and chloroalkene degradation
bcn00626  Naphthalene degradation
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_4360
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen_4360
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcen_4360
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcen_4360
   00626 Naphthalene degradation
    Bcen_4360
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcen_4360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: ABF79245
JGI: Bcen4360
UniProt: A0A0H2XX57
Position
2:complement(1586491..1587648)
Genome map
AA seq 385 aa AA seqDB search
MNPFQFRTVPTQIVEFGAARRLGALLRERFPALVRLCVVTDAFLHRSGVLAPALESLAAH
GWQVTVIDDVIADPPEHVVLEATARAVAADAEIVLGLGGGSSMDVAKLIAVLAPGQQALA
DMYGVDKVASARLPLVQMPTTAGTGSEVTAVSIVTVGEARKMGVVSPHLFADVAILDAEL
TLGLPRAATAATGIDAMVHAIEAYTSARLKNPVSDMLATHALTLLSRNLLPACDDGRNRH
AREAMLVGAMFAGQAFANAPVAAVHALAYPVGGIFHVPHGLSNALVLPHVLRFNAPAAAP
LYAELAAIAAPSATGSDEAKTHALIAEIDRLIVATGIPRTLREVGIGEADLPRMASDAML
QTRLLVNNPREVTEADALEIYRQAW
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtttcaattccgtaccgttccgacccagatcgtcgaattcggcgccgcgcgc
cggctcggcgcgctgttgcgcgaacgctttccggcgctcgtgcggctgtgcgtcgtcacc
gatgcgttcctgcatcgcagcggcgtgctcgcgcccgcgctggagagcctcgccgcgcat
ggctggcaggtcaccgtgatcgacgacgtgatcgccgatccgcccgagcacgtggtgctc
gaagccaccgcgcgggccgtcgcggccgatgccgagatcgtgctcgggctcggcggcggc
tcgtcgatggacgtcgcgaagctgatcgcggtgctcgcgccggggcagcaggcgctggcc
gacatgtacggcgtcgacaaggtcgcgagcgcgcggctgccgctcgtgcagatgccgacc
acggccggcacgggctccgaggtcacggccgtgtcgatcgtcacggtcggcgaggcgcgc
aagatgggggtcgtgtcgccgcatctgttcgcggacgtcgcgatcctcgacgcggaactc
acgctcggcctgccgcgcgcggcgacggccgccaccggcatcgacgcgatggtgcatgcg
atcgaggcgtacacgtccgcgcggctgaagaatccggtgtccgacatgctggccacgcac
gcgctgacgctgctgtcgcgcaacctgctgcccgcctgcgacgacggccggaaccggcac
gcgcgcgaagcgatgctggtcggcgcgatgttcgcggggcaggcgttcgcgaatgcgccg
gtcgcggccgtgcacgcgctggcttatcccgtgggcgggatcttccatgtgccgcacggg
ctgtcgaatgcgctggtgctgccgcacgtgctgcgcttcaatgcgccggccgccgcgccg
ctgtatgcggaactggcggccatcgccgcgccgtcggccacgggcagcgacgaagcgaaa
acgcacgcgctgatcgccgagatcgaccggctgatcgtcgcgacgggcattccgcgcacg
ttgcgggaggtcggtatcggcgaggccgacctgccgaggatggcgtcggacgcaatgctg
cagacgcgcctgctcgtgaacaatccgcgcgaggtgaccgaggccgacgcgctggagatt
taccggcaggcgtggtga

DBGET integrated database retrieval system