KEGG   Burkholderia cenocepacia AU1054: Bcen_4407Help
Entry
Bcen_4407         CDS       T00363                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00260  Glycine, serine and threonine metabolism
bcn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01130  Biosynthesis of antibiotics
bcn01230  Biosynthesis of amino acids
Module
bcn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcen_4407
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcen_4407
Enzymes [BR:bcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcen_4407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB Peripla_BP_6 His_biosynth BtpA
Motif
Other DBs
NCBI-ProteinID: ABF79289
JGI: Bcen4407
UniProt: Q1BM66
Position
2:complement(1638982..1639797)
Genome map
AA seq 271 aa AA seqDB search
MNRIKQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAAGGADVIELGVPFSDPMAD
GPVIQRSSERALARGVTLKSVLADVKRFRETDPKTPVVLMGYANPIERMGVDAFAAEAHA
AGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDERIADVGKIASGYVYYVSLK
GVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQLL
ESAAPEGAAAALKTFIAELRAALDGAGNTAR
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtattaagcagaccttcgccgcgctcgccgaacaaggccgtaagggcctgatc
ccgttcatcacggccggcgaccctgatcccgcgaaaaccgtcgaattcatgcacgcgctc
gccgccggcggcgcggacgtgatcgaactcggcgtgccgttctcggacccgatggccgac
ggccccgtgatccagcgctcgtcggaacgcgcgctcgcgcgcggcgtcacgttgaagagc
gtgctcgccgacgtgaagcgttttcgcgaaaccgaccccaaaacccccgtcgtgctgatg
ggctatgcgaacccgatcgaacggatgggcgtcgacgcattcgcggccgaagcccacgcg
gccggcgtcgacggcgtgctggtggtcgactatccgccggaagaggcgggcgtattcgcc
gagaaaatgcgtgccgcgcagatcgatccgatcttcctgctcgcgcccacgtcgaccgac
gaacgcatcgccgacgtcggcaagatcgcgagcggctacgtgtattacgtgtcgctcaag
ggcgtgaccggcgcgggaaatctggatgtttcgagcattgcaggtaaaatcccggccatc
aagtcgcgcgtgccggttccggtgggcgtcggcttcggtatccgcgacgccgaaacggcg
cgcgcggtggccgaagtgtcggacgccgtcgtgatcggcagccgcctcgtgcagctgctc
gagagcgccgcgccggaaggtgccgccgccgcgttgaagactttcatcgccgagctgcgt
gctgcgctggacggtgcgggcaacacggcgcgataa

DBGET integrated database retrieval system