KEGG   Burkholderia cenocepacia AU1054: Bcen_4409Help
Entry
Bcen_4409         CDS       T00363                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00260  Glycine, serine and threonine metabolism
bcn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01130  Biosynthesis of antibiotics
bcn01230  Biosynthesis of amino acids
Module
bcn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcen_4409
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcen_4409
Enzymes [BR:bcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcen_4409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABF79291
JGI: Bcen4409
UniProt: A0A0H2XYI2
Position
2:complement(1640747..1641940)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFQNDPDFVAEFERELKYFVGRPSP
IYHAQRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIESTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDAEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKLLLVNLSGRGDKDMHTVAERSGIEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgatgatcgcggccatttcggcccgtatggcggcgtgttcgtcgcc
gagacgctgattcacgcgctggacgaactgcgcgcggcgtatgaaaagttccagaacgat
cccgacttcgtcgccgaattcgagcgcgagctgaagtatttcgtcggccgcccgtcgccg
atctatcacgcgcagcgctggagcgagatgctcggcggcgcgcagatctacctgaagcgc
gaagacctgaaccacacgggtgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcgcatgggcaagaagcgcgtgatcgcggaaacgggcgccggccagcacggcgtc
gcgaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggctcggag
gacgtgcgccggcaggccgcgaacgtctaccggatgaagctgctgggcgcgaccgtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcacgaatatcgaaagcacgttctacatcatcggcacggtcgcgggcccgcacccgtac
ccgatgatggtgcgcgacttccagcgcgtgatcggtgacgagtgcaaggtgcagatgccc
gagctcgccggccgccagccggacgcggtgatcgcgtgcgtcggcggcgggtcgaacgcg
atgggcatcttctatccgtacatcgacgatacctcggtgcaactgatcggcgtcgaagcg
gccggcgacggcctcgacacgggccatcacgctgcctcgctgatcgccggcagccccggc
gtgctgcacggcaaccgcacgtacctgctgcaggacgacaacggccagatcatcgagacg
cattcggtgtcggcgggcctcgattatccgggcgtcggtcccgagcacgcatggctgaag
gacagcggccgcgcgcagtacgtgccgatcaccgacgcggaagcgttgaaggcgtttcac
gactgctgccggatcgaggggatcattcccgcgctcgagtcgagccacgcgatcgcgtac
ggcgtgaagctcgcgccgacgttgccgaaggacaagctcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcgagctctga

DBGET integrated database retrieval system