KEGG   Burkholderia cenocepacia AU1054: Bcen_4409Help
Entry
Bcen_4409         CDS       T00363                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcen_4409
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcen_4409
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bcen_4409
Enzymes [BR:bcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bcen_4409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:complement(1640747..1641940)
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDRGHFGPYGGVFVAETLIHALDELRAAYEKFQNDPDFVAEFERELKYFVGRPSP
IYHAQRWSEMLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECVVYMGSEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIESTFYIIGTVAGPHPYPMMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGDGLDTGHHAASLIAGSPGVLHGNRTYLLQDDNGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDAEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKLLLVNLSGRGDKDMHTVAERSGIEL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgatgatcgcggccatttcggcccgtatggcggcgtgttcgtcgcc
gagacgctgattcacgcgctggacgaactgcgcgcggcgtatgaaaagttccagaacgat
cccgacttcgtcgccgaattcgagcgcgagctgaagtatttcgtcggccgcccgtcgccg
atctatcacgcgcagcgctggagcgagatgctcggcggcgcgcagatctacctgaagcgc
gaagacctgaaccacacgggtgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcgcatgggcaagaagcgcgtgatcgcggaaacgggcgccggccagcacggcgtc
gcgaccgcgacgatctgcgcgcgcttcgggatggagtgcgtcgtctacatgggctcggag
gacgtgcgccggcaggccgcgaacgtctaccggatgaagctgctgggcgcgaccgtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcacgaatatcgaaagcacgttctacatcatcggcacggtcgcgggcccgcacccgtac
ccgatgatggtgcgcgacttccagcgcgtgatcggtgacgagtgcaaggtgcagatgccc
gagctcgccggccgccagccggacgcggtgatcgcgtgcgtcggcggcgggtcgaacgcg
atgggcatcttctatccgtacatcgacgatacctcggtgcaactgatcggcgtcgaagcg
gccggcgacggcctcgacacgggccatcacgctgcctcgctgatcgccggcagccccggc
gtgctgcacggcaaccgcacgtacctgctgcaggacgacaacggccagatcatcgagacg
cattcggtgtcggcgggcctcgattatccgggcgtcggtcccgagcacgcatggctgaag
gacagcggccgcgcgcagtacgtgccgatcaccgacgcggaagcgttgaaggcgtttcac
gactgctgccggatcgaggggatcattcccgcgctcgagtcgagccacgcgatcgcgtac
ggcgtgaagctcgcgccgacgttgccgaaggacaagctcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcgagctctga

DBGET integrated database retrieval system