KEGG   Burkholderia cenocepacia AU1054: Bcen_4432Help
Entry
Bcen_4432         CDS       T00363                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00020  Citrate cycle (TCA cycle)
bcn00190  Oxidative phosphorylation
bcn00650  Butanoate metabolism
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01200  Carbon metabolism
Module
bcn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcen_4432
   00650 Butanoate metabolism
    Bcen_4432
  Energy metabolism
   00190 Oxidative phosphorylation
    Bcen_4432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABF79314
JGI: Bcen4432
UniProt: A0A0H2XXC6
Position
2:complement(1665992..1666360)
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLVLFFGAHDFSYEGWASIFA
AQWMKLATFVMLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaacaaccgaatcggctcgaagcgcctcgtcgtcggcgcacactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcggtctacacggtcattctg
ctcgtcctgttcttcggcgcgcacgatttttcgtacgaaggctgggcatcgatcttcgcc
gcgcaatggatgaagctcgcgaccttcgtgatgctgctttccctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system