KEGG   Burkholderia cenocepacia AU1054: Bcen_4742Help
Entry
Bcen_4742         CDS       T00363                                 

Definition
alcohol dehydrogenase GroES-like protein
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:bcn01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bcn00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bcn00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:bcn00350]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:bcn00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:bcn00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
2:2013440..2014519
Genome map
AA seq 359 aa AA seqDB search
MKAAILKSLGQPLAIETIPDPVLGTGEVVVDVVATPVLSYAREVFSGERRYPIELPMVPG
CGAIGRVRQTGPDATQLQPGDWVFCDPTVRSRDDARMPDIVLQGWSARGEGGKQLQRYFH
DGPFAERLRVPTENAVRIGAIAPADAARWCALNTLLVPYGGLLASDLRAGEILLVSGATG
NFGSACIAVALAMGAQCVVAPGRNARVLAELERRFGERVRTVGLTGDETADRIRMQQAAP
GPIDCVIDLMPPSVPATTVRAAVMAVRPYGRVVLMGGVGMLGGAGLELPYPWIMRNDITL
RGKWMYPTEAVTLMTGLVRGGLLDLGHFDVTVFALDDANDAVAHAAEHGGPFRMTVIAP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgatcctgaagtcgctcggccagccgctcgcgatcgaaacgataccggac
cccgtgctcggcaccggcgaagtcgtcgtggacgtcgtcgcgacgccggttctgtcctat
gcacgggaagtgttcagcggcgagcgccgctatccgatcgagttgccgatggtgccgggc
tgcggcgcgatcggccgggtccggcaaaccggccccgacgcgacgcaattgcagccgggc
gactgggtgttctgcgacccgaccgtgcgctcgcgcgacgatgcgcggatgcccgacatc
gtgctgcagggctggagtgcgcgcggcgaaggcggcaagcagttgcagcgctatttccac
gacggcccgttcgccgagcggctgcgcgtgccgaccgagaacgcggtgcgcatcggcgcg
atcgcgccggccgacgccgcgcgctggtgcgcactcaatacgctgctcgtgccttacggc
ggcctgcttgcgtccgacctgcgcgccggcgaaatcctgctcgtcagcggcgcgaccggc
aatttcggcagcgcctgcatcgcggtggcgctggcgatgggcgcgcaatgcgtggtcgcg
cccggccgtaatgcacgcgtgctggcggagctcgaacgccgcttcggcgagcgcgtgcgc
acggtcgggctgaccggcgacgaaaccgcggaccgcatccgcatgcagcaggcggcgccg
gggccgatcgactgcgtgatcgacctgatgccgccgtcggtgccggcgacgacggtgcgt
gccgccgtgatggccgtgcgtccttatggacgcgtggtgctgatgggcggcgtcggcatg
ctcggcggagccgggctcgagctgccgtatccgtggatcatgcgcaacgacatcacgctg
cgcggcaaatggatgtacccgacggaagccgtgacgctgatgaccgggctcgtccgcggc
gggttgctcgacctcgggcatttcgacgtaacggtcttcgcgctcgacgacgcgaacgac
gcggtcgcgcatgcggcggaacatggcgggccgttcaggatgacggtgatcgcgccgtag

DBGET integrated database retrieval system