KEGG   Burkholderia cenocepacia AU1054: Bcen_4742Help
Entry
Bcen_4742         CDS       T00363                                 

Definition
(GenBank) Alcohol dehydrogenase GroES-like protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00010  Glycolysis / Gluconeogenesis
bcn00071  Fatty acid degradation
bcn00350  Tyrosine metabolism
bcn00625  Chloroalkane and chloroalkene degradation
bcn00626  Naphthalene degradation
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_4742
  Lipid metabolism
   00071 Fatty acid degradation
    Bcen_4742
  Amino acid metabolism
   00350 Tyrosine metabolism
    Bcen_4742
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bcen_4742
   00626 Naphthalene degradation
    Bcen_4742
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Bcen_4742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N PALP ADH_zinc_N_2 Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: ABF79621
JGI: Bcen4742
UniProt: A0A0H2XX84
Position
2:2013440..2014519
Genome map
AA seq 359 aa AA seqDB search
MKAAILKSLGQPLAIETIPDPVLGTGEVVVDVVATPVLSYAREVFSGERRYPIELPMVPG
CGAIGRVRQTGPDATQLQPGDWVFCDPTVRSRDDARMPDIVLQGWSARGEGGKQLQRYFH
DGPFAERLRVPTENAVRIGAIAPADAARWCALNTLLVPYGGLLASDLRAGEILLVSGATG
NFGSACIAVALAMGAQCVVAPGRNARVLAELERRFGERVRTVGLTGDETADRIRMQQAAP
GPIDCVIDLMPPSVPATTVRAAVMAVRPYGRVVLMGGVGMLGGAGLELPYPWIMRNDITL
RGKWMYPTEAVTLMTGLVRGGLLDLGHFDVTVFALDDANDAVAHAAEHGGPFRMTVIAP
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgcgatcctgaagtcgctcggccagccgctcgcgatcgaaacgataccggac
cccgtgctcggcaccggcgaagtcgtcgtggacgtcgtcgcgacgccggttctgtcctat
gcacgggaagtgttcagcggcgagcgccgctatccgatcgagttgccgatggtgccgggc
tgcggcgcgatcggccgggtccggcaaaccggccccgacgcgacgcaattgcagccgggc
gactgggtgttctgcgacccgaccgtgcgctcgcgcgacgatgcgcggatgcccgacatc
gtgctgcagggctggagtgcgcgcggcgaaggcggcaagcagttgcagcgctatttccac
gacggcccgttcgccgagcggctgcgcgtgccgaccgagaacgcggtgcgcatcggcgcg
atcgcgccggccgacgccgcgcgctggtgcgcactcaatacgctgctcgtgccttacggc
ggcctgcttgcgtccgacctgcgcgccggcgaaatcctgctcgtcagcggcgcgaccggc
aatttcggcagcgcctgcatcgcggtggcgctggcgatgggcgcgcaatgcgtggtcgcg
cccggccgtaatgcacgcgtgctggcggagctcgaacgccgcttcggcgagcgcgtgcgc
acggtcgggctgaccggcgacgaaaccgcggaccgcatccgcatgcagcaggcggcgccg
gggccgatcgactgcgtgatcgacctgatgccgccgtcggtgccggcgacgacggtgcgt
gccgccgtgatggccgtgcgtccttatggacgcgtggtgctgatgggcggcgtcggcatg
ctcggcggagccgggctcgagctgccgtatccgtggatcatgcgcaacgacatcacgctg
cgcggcaaatggatgtacccgacggaagccgtgacgctgatgaccgggctcgtccgcggc
gggttgctcgacctcgggcatttcgacgtaacggtcttcgcgctcgacgacgcgaacgac
gcggtcgcgcatgcggcggaacatggcgggccgttcaggatgacggtgatcgcgccgtag

DBGET integrated database retrieval system