KEGG   Burkholderia cenocepacia AU1054: Bcen_4877Help
Entry
Bcen_4877         CDS       T00363                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bcen_4877
Enzymes [BR:bcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bcen_4877
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
2:complement(2139238..2141208)
Genome map
AA seq 656 aa AA seqDB search
MHLGVCYYPEHWPREQWERDALRMAELGLTRVRIAEFAWSRMEPAPGRYDWAWLDEAIDT
LARQQLKIVLGTPTAAPPKWLVDRHPEMLPVAADGAVWQFGSRRHYDIASPVYREHCVRI
VDAMARRYGTHPAVIAWQTDNELGCHNTLPSYTRAALEGFRAWLAVRYGDIDALNRAWGN
VFWSMEYRGFDEIELPRHTPTDANPAHLLDFRRYQSDEVARFHAVQVDAIRPHAPGRDVL
HNFMGFFTEFDHHAFARGGLDVAAWDSYPVPRTEVLPLDEADKRRWARTGHPDVSAFSHD
LYRGIGNGRMWVMEQQAGPVNWGPYNPVPHAGAVRLWTWEAFAHGAELVSYFRWRQYPHA
QEQLHSGLNAPDDRLSPGGREVARVACELAALDPAFVGGPRETARVALLFDYEADWMIRI
QPHGADFDYQQHAFDWYRALRELGLDVDIVAAGADLSRYALVVAPTLPVVTDRIVEQVAG
GFAHWLFGPRTGSRTAAFAIAPGLAPGKLRDVLPVRIGQVESLRPSLAPRVSFDGVDGHA
LKWRDHIDREAAPGVDVLAACDDGVPALVRRAHVTMATACFDRALLRAIVSRCARDAGLQ
VRALPDGVRLRRRGRVTFAFNYGDAPCLLPAPDGARFVLGGRELGAVDVAAWVEPD
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgcacctcggcgtttgctattaccccgaacactggccgcgcgaacaatgggagcgcgat
gcgctgcgcatggccgaactgggcctgacgcgcgtgcggatcgccgaattcgcgtggagc
cggatggagccggcgcccggccgctacgactgggcatggctcgacgaagcgatcgacacg
ctcgcgcgtcagcagttgaagatcgtgctcggcacaccgaccgccgcgccgccgaaatgg
ctcgtcgatcgtcatccggagatgctgccggtggccgccgacggcgcggtgtggcagttc
ggctcgcgccgccattacgacatcgcgagccccgtgtatcgcgagcactgcgtgcgcatc
gtggacgcgatggcgcgacgctacggcacgcatccggcagtcatcgcatggcagaccgac
aacgagctcggctgtcacaacacgctgccgagctatacgcgtgcggcgctcgaagggttt
cgcgcgtggctcgccgtgcgctatggcgacatcgatgcgctgaatcgtgcatggggcaac
gtgttctggagcatggagtatcgcggtttcgacgagatcgaattgccgcgccatacgccg
accgatgcgaatcccgcccatctgctcgacttccgccgctatcagtcggacgaggtcgcg
cggttccacgccgtgcaggtcgatgcgatccgtccgcacgcgccgggccgcgatgtgctg
cacaacttcatgggcttttttaccgagttcgatcaccatgcgtttgcgcgcggcgggctc
gacgtcgctgcgtgggacagctatccggtcccgcgtaccgaagtactgccgctcgacgaa
gcggacaagcggcgctgggctcgtaccggccacccggacgtttcggcgttctcgcacgac
ctgtatcgcggcatcggcaacgggcggatgtgggtgatggagcaacaggccgggccggtg
aactgggggccgtacaacccggtgccgcacgcaggcgcggtgcggctgtggacgtgggaa
gcgttcgcgcatggcgcggagctcgtgtcgtatttccgctggcggcagtatccgcatgcg
caggagcaactgcattcggggctcaacgcaccggacgaccggctgtcgccgggcggtcgt
gaagtggcgcgtgtggcgtgcgaactggccgcgctggatcccgcgttcgtcggcggtccg
cgtgagacggcccgcgtcgcgctgctgttcgactacgaggccgactggatgatccggatc
cagccgcacggcgccgacttcgactatcagcagcacgcgttcgactggtatcgcgcgctg
cgcgagctgggcctcgacgtcgacatcgtcgcggccggcgccgacctgtcgcgttatgcg
ctcgtcgtcgcgccgacgctgccggtcgtcacggatcgcatcgtcgagcaggttgcgggc
ggattcgcccactggctgttcgggccgcgcacgggttcacgcaccgcggcattcgcgatc
gcgccgggtctcgcaccgggcaagctgcgcgacgtgctgccggtgaggatcggccaggtc
gagtcgctgcggccatcgctcgcgccgcgtgtctcgttcgatggcgtcgacggccatgcg
ctgaaatggcgcgatcacatcgacagggaagcggcaccgggcgtcgacgtgctcgccgcg
tgcgacgacggcgtgccggcactcgtgcggcgcgctcacgtgacgatggcgaccgcctgt
ttcgaccgcgcgctgttgcgcgcgatcgtctcccgctgcgcgcgagatgccgggttgcag
gtacgggcgctcccggacggtgtgcggttgcgtcgacgcgggcgcgtcacgttcgcgttc
aactacggcgacgcaccctgcctgctgcccgcgccggacggtgcgcgctttgtgctcggc
ggccgggaactcggcgcggtggacgttgccgcctgggtcgagccggactga

DBGET integrated database retrieval system