KEGG   Burkholderia cenocepacia AU1054: Bcen_4917Help
Entry
Bcen_4917         CDS       T00363                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00010  Glycolysis / Gluconeogenesis
bcn00020  Citrate cycle (TCA cycle)
bcn00620  Pyruvate metabolism
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01200  Carbon metabolism
Module
bcn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_4917
   00020 Citrate cycle (TCA cycle)
    Bcen_4917
   00620 Pyruvate metabolism
    Bcen_4917
Enzymes [BR:bcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcen_4917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 HlyD_D23 CAT
Motif
Other DBs
NCBI-ProteinID: ABF79793
JGI: Bcen4917
UniProt: A0A0H2XXM1
Position
2:complement(2183654..2185015)
Genome map
AA seq 453 aa AA seqDB search
MKCLLLETNVRVTRIEVPDIGDYKNIPVIEVLVGVGQRVEREQSLVVLESDKATMDVPSP
TAGVIKEMKVAVGETVSQGTLIALLDSDGERQDDAAPVPPAASAARDLACPSANVATGLV
PALAPAPELNSASAPLHHAPAREGEPSRASHASPSVRKFARELGVDVARVSGSGPKGRIT
KDDITGFVKGVMSGQRAAPGAAAAPAGGGELNLLPWPKVDFAKFGPFEPKPLSRIKKISG
ANLHRNWVMIPHVTNNDEADITELEALRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFP
TFNASLDGDNLVFKQYYHIGFAADTPNGLVVPVIRDADKKGLVDIAKEMAELSKAARDGK
LKPDQMLGGCFSISSLGGIGGTHFTPIINAPEVAILGLSRGQMKPVWDGKQFVPRLTMPL
SLAFDHRVIDGAEAARFNAYLGALLADFRRIIL
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatgcttgctgttggagacgaatgtgcgggtgacacgaatagaagtgccggatatc
ggcgattacaagaacatccccgtgatcgaagttctggtgggagtcggacaacgcgtcgaa
cgggagcagtcgctcgtcgtgctcgagtcggacaaggcgacgatggatgtgcccagtccc
accgctggcgtgatcaaggagatgaaggtcgccgtcggcgagacggtgtcgcaaggcacg
ttgatcgcgctgctcgacagcgacggcgagcggcaggacgacgcggcgcctgtgcctccg
gccgcctcggctgcgcgcgatctcgcgtgtccgtcggcgaatgtcgcgacagggctggtg
ccggcgcttgcgccggcgcccgaactgaactccgcatccgcgccattgcatcacgcgccg
gcgcgcgaaggcgagccgtctcgcgccagccacgcatcgccgtcggtgcgcaagttcgcg
cgcgagctcggcgtcgacgtcgcgcgcgtgtcgggcagcggcccgaagggccgcatcacc
aaggacgacatcacgggcttcgtgaagggcgtgatgtcgggccagcgcgcggcgccgggc
gcggcagccgcgccggcaggcggcggcgagctgaacctgctgccgtggccgaaggtcgac
ttcgcgaagttcggcccgttcgagccgaagccgctgtcgcgcatcaagaagatctcgggc
gcgaacctgcatcgcaactgggtgatgatcccgcacgtcacgaacaacgacgaagcggac
atcaccgagctcgaagcgctgcgcgtgcagctgaacaaggagcacgaaaaggcgggcgtg
aagttcacgatgctcgcgttcgtgatcaaggcggtggtggccgcgctgaagaaattcccg
accttcaacgcgagcctcgacggcgacaacctggtgttcaagcagtactaccacatcggg
ttcgcggccgacacgccgaacggtctggtcgtgccggtgatccgcgatgcggacaagaag
ggcctcgtcgacatcgcgaaggaaatggccgagctgtcgaaggccgcgcgcgacggcaag
ctcaagcccgatcagatgctgggtggctgcttctcgatctcgtcgctcggcgggatcggc
ggcacgcacttcacgccgatcatcaacgcgccggaagtggcgatcctcgggttgtcgcgc
gggcagatgaagccggtgtgggacggcaagcagttcgtgccgcggttgacgatgccgctt
tccctggcgttcgatcatcgcgtgatcgatggcgccgaagccgcgcggttcaatgcttat
cttggcgcgttgctcgcggatttccgtcgcatcattctttga

DBGET integrated database retrieval system