KEGG   Burkholderia cenocepacia AU1054: Bcen_5116Help
Entry
Bcen_5116         CDS       T00363                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00790  Folate biosynthesis
bcn01100  Metabolic pathways
Module
bcn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcen_5116
Enzymes [BR:bcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bcen_5116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABF79990
JGI: Bcen5116
UniProt: A0A0H2XY91
Position
2:2399236..2399871
Genome map
AA seq 211 aa AA seqDB search
MGKGKKTTQPQPVASRPSREEAEDAVRVLLRWAGDDPAREGLLDTPARVVRAYEQFFAGY
ALEPRDILARTFSEVDGYDEMIVLKDIRFESYCEHHMVPIIGRAHVAYLPNHRVVGISKL
ARLVDAFAKRLQIQEKMTVQIADTLFDVLQPKGVGVILEAAHQCISTRGVHKPGVEMVTS
RMLGTFRTDPSTRREFLSIVANPSSVNLTNT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagggaaagaaaaccacacagccccagccggtcgcctcgcggccgagccgtgaa
gaagccgaagacgccgtccgcgtgctgttgcgctgggccggcgacgatcccgcgcgcgaa
ggcctgctcgacacgcccgcgcgcgtggtgcgcgcatacgagcagttcttcgccggctat
gcgctggagccgcgcgacatcctcgcgcgcacgttcagcgaagtcgacggctacgacgaa
atgatcgtgctgaaggacatccgcttcgagagctactgcgagcaccatatggtgccgatc
atcggccgcgcgcacgtcgcgtatctgccgaaccatcgcgtcgtcggcatctcgaagctc
gcgcgcctcgtcgacgcgttcgcgaagcgcctgcagatccaggaaaagatgaccgtgcag
atcgccgacacgctgttcgacgtgctgcagccgaagggcgtcggcgtgatcctcgaagcc
gcgcaccagtgcatctccacgcgcggcgtgcacaagccgggcgtcgagatggtcacgtcg
cgcatgctcggcacgttccgcaccgatccgtcgacgcgtcgcgaattcctgtcgatcgtc
gcgaatccttcctcggtcaacctgacgaatacctga

DBGET integrated database retrieval system