KEGG   Burkholderia cenocepacia AU1054: Bcen_5202Help
Entry
Bcen_5202         CDS       T00363                                 

Definition
(RefSeq) beta-galactosidase (EC:3.2.1.23)
  KO
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Bcen_5202
Enzymes [BR:bcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Bcen_5202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(2491177..2493171)
Genome map
AA seq 664 aa AA seqDB search
MRLGVCYYPEHWPESMWADDARRMKALGIEQVRIAEFAWSRIEPSPGEYDWGWLDRAVDV
LGAAGLEIVMCTPTATPPKWLVDRHPDILAIGADGRPRAFGSRRHYDFSSPVYLEASRQI
CTAVAERYGRHPAVRYWQTDNELGCHQTVVSYSPAALVRFREWLKARYGTIDALNRAWGT
VFWSMEYRHFDEVDAPVGTVTEANPSHRLDYRRFASDELARYHRMQVDVIRAHSPGRPVA
HNFMQLFTEFDHYEVARDLDLATWDSYPLGALEELWFAPDVKARWLRTGHPDFASFNHDL
YRGMSKLPFWVMEQQPGPVNWAHWNPAPLPGMVRLWSWEAFAHGAGCVSYFRWRQAPFAQ
EQMHAGLNTPDNRLDEGGREAQRVAQEIAAVLDAGADADANGAVRAPVALVFDYDAKWLF
EVQPQGADFHYPRFAFEYYSALRSLGLDVDIVSAHAPLDGYRLVVVPPLPVVPDDFASRL
AASGAHAVFGPRTGSKTIDLQIPPALPPGPLASILPVRVWRVESLRPNVTERVDGTLRDG
SPLAGDARHWRDLVELNDDDTRSVVHARFADGHPACLSHGTLHYWAALFDEATTVRLFAD
IAAEAGLAPTPLGDAVRVSRRGGLTYVFNYAGTPHTIDGVPPSAFVFGGAQVEPQGVAVY
RSRS
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcggagtctgttactacccggaacactggccggaatcgatgtgggccgacgac
gcccgccggatgaaagcgctcggcatcgagcaggtgcggatcgccgaattcgcgtggagc
cgcatcgagccgtcgccgggcgaatacgactggggctggctcgaccgtgcggtcgacgtg
ctcggcgcggccggcctcgaaatcgtgatgtgcacgccgaccgcgacgccgccgaaatgg
ctggtggaccgccatcccgacatcctcgcgatcggcgcggacggccgcccgcgcgcgttc
ggttcgcgccgccactacgatttctcgtcgccggtctatctcgaagcgtcgcgccagatc
tgcacggcggtcgccgaacgctacggtcgccacccggccgtgcgctactggcagaccgac
aacgaactcggctgccaccagaccgtcgtcagctactcgccggccgcgctcgtgcgcttt
cgcgaatggctgaaagcacgctacggcacgatcgacgcgctgaaccgcgcatggggcacc
gtgttctggagcatggaatatcgccatttcgacgaagtggacgcgcccgtgggcaccgtg
accgaagccaatccgtcgcatcgcctcgactaccggcgcttcgcgtccgacgaactcgcg
cgctatcaccggatgcaggtcgacgtgatccgcgcgcattcgccgggccgcccggtcgcg
cacaacttcatgcagctcttcaccgagttcgatcactacgaagtcgcgcgcgacctcgat
ctcgcgacgtgggacagctatccgctcggcgcgctcgaggagctgtggttcgcgcccgac
gtgaaggcgcgctggctgcgcaccggccatcccgatttcgcgtcgttcaatcacgacctg
taccgcggcatgtcgaagctgccgttctgggtgatggagcagcagccgggcccggtgaac
tgggcgcactggaaccccgcgccgctgccgggcatggtgcggctgtggagctgggaagcg
ttcgcgcacggcgccggctgcgtgtcgtacttccgctggcggcaggcgccgtttgcgcag
gagcagatgcacgcgggcctgaatacccccgacaaccggctcgacgaaggcggccgcgaa
gcgcagcgcgtcgcgcaggaaatcgccgccgtgctcgacgccggcgccgatgccgacgcg
aacggcgcggtgcgcgcccccgttgcgctggtgttcgactacgacgcgaagtggctgttc
gaagtgcagccgcaaggcgccgatttccactacccgcgtttcgcattcgagtactactcg
gcgctgcgttcgctcgggctcgacgtcgacatcgtttccgcgcacgcgccgctcgacggc
taccggctcgtcgtcgtgccgccgctgccggtcgtgccggacgatttcgcgtcgcggctc
gccgcgtcgggcgcccatgcggtgttcggcccgcgcaccggctcgaaaaccatcgacctg
cagattccgccggcgttgccgcccggccccctcgcgtcgatcctgccggtacgcgtgtgg
cgcgtcgagtcgctgcggccgaacgtcaccgaacgagtcgacggcacgctgcgcgacggt
tcgccgctcgcgggcgacgcgcgtcactggcgcgatctcgtcgagctcaacgacgacgac
acacgcagcgtcgtgcacgcacgcttcgccgacggtcacccggcctgcctgtcgcacggc
acgctgcattactgggccgcgctgttcgacgaggcgaccaccgtgcgcctgttcgccgat
atcgcggccgaagcgggcctggccccgacgccgctcggcgacgccgtgcgcgtgagccgg
cgcggcggcctgacttacgtattcaactacgcgggcacgccgcacacgatcgatggcgta
ccgccgtccgcgttcgtgttcggcggcgcgcaggtcgagccgcaaggcgtcgccgtgtat
cgaagccgttcctag

DBGET integrated database retrieval system