KEGG   Burkholderia cenocepacia AU1054: Bcen_5245Help
Entry
Bcen_5245         CDS       T00363                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bcn00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
2:2539875..2540657
Genome map
AA seq 260 aa AA seqDB search
MAETLNLTKEALVALAERRLENEVGDSGWSARQKLALTCRILFDAGHDSGLAGQITCRAD
AAGTYYTQRLGLGFDEILAANLLRVNEDLDVVDGDGIPNPANRFHTWIYRERPDVNCIIH
THPAHVAALSMLEQPLVVSHMDTCPLYDDCAFLKDWPGVPVGNEEGEIISKALGSKRAIL
LSHHGQLVVGKTIEEACILALLIERAAKLQLLAMSAGEIKPVPPALAREAHDWISKPKRD
AVTFDYYARRALHTHQDCVA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgctgaatttgacgaaggaagcgctggtcgcgctggcagagcggcgtctg
gaaaacgaggtgggggacagcggctggtccgcgcgacaaaagcttgcgctgacctgccgg
attttgttcgacgccggccacgactcgggcctggccgggcagatcacctgccgcgcggac
gcggccggcacgtactacacgcagcggctcgggctcggcttcgacgagatcttggccgcg
aacctgctgcgcgtcaacgaggatctcgacgtcgtcgacggcgatggcattccgaacccg
gccaaccggttccatacgtggatttatcgcgaacgcccggacgtgaactgcatcatccat
acgcatcccgcgcatgtcgcggcgctgtcgatgctcgaacagccgctcgtcgtgtcgcat
atggatacctgcccgctgtacgacgattgtgcgttcctgaaggactggccgggcgtgccg
gtcggcaacgaggagggcgagatcatctcgaaggcgctcggcagcaagcgcgcgattctg
ctgtcgcatcacggtcagctcgtggtcggcaagacgatcgaggaggcgtgcattctcgcg
ctgttgatcgaacgcgccgcgaagcttcaactgctcgcgatgtcggccggcgagatcaaa
ccggtgcctccggcgttggcgcgtgaggcgcacgactggatctcgaagcccaagcgcgat
gcggtgacgttcgactactacgcgcgccgcgcattgcatacgcatcaggattgcgtcgcg
taa

DBGET integrated database retrieval system