KEGG   Burkholderia cenocepacia AU1054: Bcen_5245Help
Entry
Bcen_5245         CDS       T00363                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Bcen_5245
Enzymes [BR:bcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Bcen_5245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:2539875..2540657
Genome map
AA seq 260 aa AA seqDB search
MAETLNLTKEALVALAERRLENEVGDSGWSARQKLALTCRILFDAGHDSGLAGQITCRAD
AAGTYYTQRLGLGFDEILAANLLRVNEDLDVVDGDGIPNPANRFHTWIYRERPDVNCIIH
THPAHVAALSMLEQPLVVSHMDTCPLYDDCAFLKDWPGVPVGNEEGEIISKALGSKRAIL
LSHHGQLVVGKTIEEACILALLIERAAKLQLLAMSAGEIKPVPPALAREAHDWISKPKRD
AVTFDYYARRALHTHQDCVA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaacgctgaatttgacgaaggaagcgctggtcgcgctggcagagcggcgtctg
gaaaacgaggtgggggacagcggctggtccgcgcgacaaaagcttgcgctgacctgccgg
attttgttcgacgccggccacgactcgggcctggccgggcagatcacctgccgcgcggac
gcggccggcacgtactacacgcagcggctcgggctcggcttcgacgagatcttggccgcg
aacctgctgcgcgtcaacgaggatctcgacgtcgtcgacggcgatggcattccgaacccg
gccaaccggttccatacgtggatttatcgcgaacgcccggacgtgaactgcatcatccat
acgcatcccgcgcatgtcgcggcgctgtcgatgctcgaacagccgctcgtcgtgtcgcat
atggatacctgcccgctgtacgacgattgtgcgttcctgaaggactggccgggcgtgccg
gtcggcaacgaggagggcgagatcatctcgaaggcgctcggcagcaagcgcgcgattctg
ctgtcgcatcacggtcagctcgtggtcggcaagacgatcgaggaggcgtgcattctcgcg
ctgttgatcgaacgcgccgcgaagcttcaactgctcgcgatgtcggccggcgagatcaaa
ccggtgcctccggcgttggcgcgtgaggcgcacgactggatctcgaagcccaagcgcgat
gcggtgacgttcgactactacgcgcgccgcgcattgcatacgcatcaggattgcgtcgcg
taa

DBGET integrated database retrieval system