KEGG   Burkholderia cenocepacia AU1054: Bcen_5668Help
Entry
Bcen_5668         CDS       T00363                                 

Definition
dihydrokaempferol 4-reductase (EC:1.1.1.219)
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
bcn  Burkholderia cenocepacia AU1054
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
3:204274..205365
Genome map
AA seq 363 aa AA seqDB search
MAHHFCNGIPPMNIDTDLPVMVTGATGYVAGWLVQRLLEAGVTVHAAVRDPDSPDKLEHL
QRIAAGKPGTLRYFRADLLEPGSYADAMAGCGTVFHTASPFTVTVRDPQKELVDPALLGT
RNVLETANRTPSVRRVVLTSSCAAIYGDNADLAATPDGVFTESIWNTSSSLTHQPYSYSK
TVAEREAWKIARQQQRWDLVTVNPSLVIGPGINPYATSESFEIVRQMGNGTMKAGVPDLG
LGAVDVRDVADAHLRAAFLPNANGRYIVSAHDTNLPAMAATLLERYGADYPIPRRILPKW
LVWLIGPLANKSVTRRVVARNIGLPWRADNSRSRNELGMRYRPLAESMNDFFQQLVETGQ
LRR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgcatcacttctgcaatggaatcccgcccatgaatatcgataccgaccttcccgtc
atggtgaccggcgcgaccggctacgtcgcgggctggctcgtgcagcggctgctcgaggcc
ggcgtgacggtccatgcggccgtccgcgaccccgacagccccgacaagctcgagcatctg
cagcgcatcgcggccggcaagcccggcaccctccgctatttccgcgcggacctgctcgaa
cccgggtcgtacgccgacgcgatggccggttgcggaaccgtattccataccgcgtcgccc
ttcaccgtcaccgtccgcgatccgcagaaggagctggtcgatccggcgctgctcggcacg
cgcaacgtactcgagacggccaaccgcacgccgtcggtgcggcgcgtcgtgctgaccagc
agttgcgcggcgatctacggcgacaacgccgacctcgccgcgacgcccgatggtgtgttc
accgaatcaatctggaacaccagttcgtcgctgacccaccagccctattcgtattcgaag
acggtcgccgagcgcgaagcgtggaagatcgcccgccagcagcaacgctgggatctcgtc
accgtcaacccatcgctcgtgatcgggcccggcatcaacccgtacgcgacgtcggaaagc
ttcgaaatcgtgcggcagatgggcaacggcacgatgaaggccggcgtgccggatctcggc
ctgggtgcggtggatgtccgcgacgtggccgatgcgcatctgcgtgcggcgttcctgccg
aacgccaacggccgttacatcgtgtcggcgcacgacacgaacctgccggcgatggccgcc
acgctgctggaacggtatggcgccgactacccgattccgcggcgcatcctgccgaaatgg
ctggtgtggctgatcggcccgctcgcgaacaagagcgtgacgcgccgcgtggtcgcgcgc
aacatcgggctgccctggcgcgccgacaacagccgcagccgcaacgagctcgggatgcgc
tatcgcccgctcgccgagtcgatgaacgacttctttcagcagctcgtcgaaaccgggcaa
ttgcggcgatga

DBGET integrated database retrieval system