KEGG   Burkholderia cenocepacia AU1054: Bcen_5865Help
Entry
Bcen_5865         CDS       T00363                                 

Definition
(GenBank) 3-hydroxybutyrate dehydrogenase
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00072  Synthesis and degradation of ketone bodies
bcn00650  Butanoate metabolism
bcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcen_5865
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bcen_5865
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     Bcen_5865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR THF_DHG_CYH_C Epimerase 3HCDH_N IF2_N
Motif
Other DBs
NCBI-ProteinID: ABF80730
JGI: Bcen5865
UniProt: A0A0H2Y2M6
Position
3:427127..427915
Genome map
AA seq 262 aa AA seqDB search
MAADLSGKTAVVTGAASGIGKEIALELAKAGAAVAIADLNQDGANAVADEINKAGGKAIG
VAMDVTNEDAVNSGIDKVAEAFGSVDILVSNAGIQIVNPIENYSFSDWKKMQAIHVDGAF
LTTKAALKHMYKDDRGGVVIYMGSVHSHEASPLKSAYVTAKHGLLGLARVLAKEGAKHNV
RSHVVCPGFVRTPLVDKQIPEQAKELGISEEEVIKKVMLGNTVDGVFTTVQDVAQTVLFL
SAFPSAALTGQSVVVSHGWFMQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggcagcagatctgagcggcaagaccgcagtcgtcacgggcgccgcgagcggcatcggc
aaggaaatcgcactcgagctggccaaggccggcgcggccgtcgcgatcgccgacctgaac
caggacggcgcgaacgcggtcgccgacgagatcaacaaggcaggcggcaaggcgatcggc
gtcgcgatggacgtgaccaacgaagacgccgtgaacagcggcatcgacaaggtggccgaa
gcgttcggctcggtcgacatcctcgtgtcgaacgcgggcatccagatcgtcaacccgatc
gagaactattcgttctccgactggaagaagatgcaggcgatccacgtggacggcgcgttc
ctgacgacgaaggccgcgctcaagcacatgtacaaggacgatcgcggcggcgtcgtgatc
tacatgggctcggtgcactcgcacgaggcgtcgccgctgaagtcggcgtacgtgacggcc
aagcatggcctgctgggcctcgcccgcgtgctggcgaaggaaggcgcgaagcacaacgtg
cgctcgcacgtcgtgtgtccgggcttcgtgcgcacgccgctggtcgacaagcagattccg
gagcaggcgaaggagctcggcatcagcgaagaggaagtgatcaagaaggtgatgctgggc
aacacggtcgacggcgtgttcacgacggtgcaggacgtcgcgcagacggtgctgttcctg
tcggcgttcccgagcgccgcgctcacgggccagtcggtggtcgtcagccacggctggttc
atgcagtaa

DBGET integrated database retrieval system