KEGG   Burkholderia cenocepacia AU1054: Bcen_5886Help
Entry
Bcen_5886         CDS       T00363                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00010  Glycolysis / Gluconeogenesis
bcn00620  Pyruvate metabolism
bcn00640  Propanoate metabolism
bcn00680  Methane metabolism
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_5886
   00620 Pyruvate metabolism
    Bcen_5886
   00640 Propanoate metabolism
    Bcen_5886
  Energy metabolism
   00680 Methane metabolism
    Bcen_5886
Enzymes [BR:bcn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bcen_5886
Lipid biosynthesis proteins [BR:bcn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bcen_5886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABF80751
JGI: Bcen5886
UniProt: A0A0H2Y0D1
Position
3:447610..449592
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHETRQFAPPAALEKTATISGMPAYRALVAEAEQDYEGFWARLAREGLTWHKP
FTKVLDERNAPFYTWFDDGELNASYNCLDRHVEAGNGERVAVIFEADDGTVTRVTYADLL
ARVSRFANALKKRGIGKGDRVVIYIPMSIEGIVAMQACARIGATHSVVFGGFSAKSLNER
LVDVGAVALITADEQARGGKTLPLKSIADEAIALGGCEAVKSVIVYRRTGGKIDWHAERD
LWMHELTDGESDQCEPTWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMKWTFD
WKPDDVFWCTADIGWVTGHTYITYGPLACGGTQVVFEGVPTYPDAGRFWKMIGDHKVTVF
YTAPTAIRSLIKAAEADDKVHPKSYDLSSLRIIGTVGEPINPEAWMWYHKHVGHERCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGITAAVVDETGQDVPNGQGGILVVKRPW
PAMIRTIWGDPERFKKSYYPEELGGTLYLAGDGTVRDKETGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAKTLRDWVG
KQIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILEQLTEVR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttcttcacgaaacccgtcagttcgcgccgcccgcggcgctc
gagaagacggcgaccatttccggcatgccggcctaccgcgcgctcgtcgccgaggccgag
caggattacgaaggcttctgggcgcgcctcgcgcgcgaaggcctcacgtggcacaagccg
ttcaccaaggtgctcgacgagcgcaacgcgccgttctacacatggttcgacgacggcgag
ctgaacgcgtcgtacaactgcctcgaccgccacgtcgaagccggcaacggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacccgcgtcacctatgcggacctgctc
gcacgcgtgtcgcgtttcgccaatgcgctgaagaaacgcggcatcggcaagggcgatcgc
gtcgtcatctacattccgatgtcgatcgaaggcatcgtcgcgatgcaggcctgcgcgcgc
atcggcgcgacgcactcggtcgtgttcggcggcttctccgcgaaatcgctgaacgagcgg
ctcgtcgacgtcggcgcggtcgcgctgatcaccgccgacgagcaggcgcgcggcggcaag
acgctgccgctcaagagcatcgccgacgaagcgatcgcgctgggcggctgcgaagcggtc
aagagcgtgatcgtctatcgccgcaccggcggcaagatcgactggcatgcggagcgcgac
ctctggatgcatgagctgaccgacggcgaatccgaccaatgcgagccgacctgggtcggc
gccgagcatccgctgttcatcctgtatacgtcgggctcgaccggcaagccgaagggcgtg
cagcacagcacgggcggctacctgctgtgggccgcgcagacgatgaagtggaccttcgac
tggaaacccgacgacgtgttctggtgcacggccgacatcggctgggtcacgggccacacg
tacatcacctacggcccgctcgcgtgcggcggcactcaggtcgtgttcgaaggcgtgccg
acgtatccggacgccggccgcttctggaagatgatcggcgatcacaaggtcaccgtgttc
tacaccgcaccgaccgcgatccgttcgctgatcaaggcggccgaagcggacgacaaggtc
catccgaagagctatgacctgtcgagcctgcgcatcatcggcacggtcggcgagccgatc
aatccggaagcgtggatgtggtaccacaagcacgtcggccacgagcgctgcccgatcgtc
gacacgtggtggcagaccgaaaccggcggccacatgatcacgccgctgccgggcgcgacg
ccgaccgtaccgggctcgtgcacgctgccgctgccgggcatcacggccgcggtggtcgac
gagacgggtcaggacgtgccgaacgggcaaggcggcattctggtcgtcaagcgcccgtgg
ccggcgatgatccgcacgatctggggcgacccggagcgcttcaagaagagttactacccg
gaagaactcggcggcacgctctatctggccggcgacggcaccgtgcgcgacaaggagacc
ggctacttcacgatcatgggccggatcgacgacgtgctgaacgtgtcgggccaccggctg
ggcacgatggagatcgaatcggcgctggtgtcgcatgagctggtggccgaggcggcggtg
gtcggccgtccggacgacacgaccggtgaagcggtcgtggcgttcgtcgtgctgaagcgc
tcgcgtccggaaggcgaagaagcggcggcgctcgcgaagacgctgcgcgactgggtgggc
aagcagatcgggccgatcgcgaagccgaaggacatccgtttcggcgacaacctgccgaag
acccgctcgggcaagatcatgcggcgcctgctgcgctcgctcgcgaagggcgaggcgatc
acgcaggatacgtccacgctcgagaatccggccatcctcgagcagctcaccgaagtgcgc
tga

DBGET integrated database retrieval system