KEGG   Burkholderia cenocepacia AU1054: Bcen_6025Help
Entry
Bcen_6025         CDS       T00363                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcen_6025
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcen_6025
   00630 Glyoxylate and dicarboxylate metabolism
    Bcen_6025
Enzymes [BR:bcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bcen_6025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
3:complement(613499..615091)
Genome map
AA seq 530 aa AA seqDB search
MSTPITLPQGMTITGEIKPGYEAILTPDALALVAALHRTFESRRQALLQARVERTKRLDA
GERPDFLAETKAIREGDWKVAPLPADLQCRRVEITGPVERKMIINALNSGADSYMTDFED
SNAPSWTNQIDGQINLKDAVRRTISLEQNGKSYRLNDKVATLIVRPRGWHLDEKHVTVDG
QRVSGGIFDFALFLFHNAKELLARGSGPYFYLPKMESHLEARLWNDIFVAAQEAVGVPRG
TIRATVLIETILAAFEMDEILYELREHSSGLNAGRWDYIFSAIKKFKNDRDFCLADRSKI
TMTVPFMRAYALLLLKTCHKRNAPAIGGMSALIPIKNDPEANDKAMGGVRSDKQRDATDG
YDGGWVAHPGLVPIAMEEFVKVLRDKPNQIAKQRDDVQVEGRNLLDFQPEAPITEAGLRN
NINVGIHYLGAWLDGNGCVPIHNLMEDAATAEISRSQVWQWIRSPKGVLDDGRKVTAELV
REFAKIELDNVKRAVGGNTQPYERAAAIFEQMSTSEGFTEFLTLPLYEEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccccgatcacgctgccgcaaggcatgacgatcaccggcgaaatcaagccgggt
tacgaagccatcctgacgcccgacgcgctggcactcgtcgcggcgctgcaccgcacgttc
gaatcgcgccgccaggcgctgctgcaggcgcgcgtcgagcgcacgaaacgcctcgacgcg
ggcgagcgccccgatttcctggccgagacgaaggcgatccgcgaaggcgactggaaggtc
gcgccgctgccggccgacctgcaatgccgccgggtcgagatcacggggcccgtcgagcgc
aagatgatcatcaacgcgctgaactcgggcgccgattcgtacatgacggacttcgaggat
tcgaacgcgccgagctggacgaaccagatcgacggccagatcaacctgaaggacgcggtg
cgccgcacgatctcgctcgagcagaacggcaagtcgtaccggctgaacgacaaggtcgcg
acgctgatcgtgcgtccgcgcggctggcacctcgacgagaagcacgtgacggtcgacggc
cagcgcgtgtccggcggcatcttcgatttcgcgctgttcctgttccacaacgcgaaggaa
ctgctcgcgcgcggctcgggcccgtacttctacctgccgaagatggaaagccatctcgag
gcgcgcctgtggaacgacatcttcgtcgccgcgcaggaagcggtcggcgtgccgcgcggc
acgatccgcgcgacggtgctgatcgaaacgatcctcgccgcgttcgagatggacgagatc
ctgtacgaactgcgcgaacacagctcgggcctgaacgccggccgctgggactacatcttc
tcggcgatcaagaagttcaagaacgaccgcgacttctgcctggccgaccgttcgaagatc
acgatgacggtgccgttcatgcgtgcgtacgcactgctgctgctgaagacctgccacaag
cgcaacgcgccggcgatcggcgggatgagcgcgctgattccgatcaagaacgatccggaa
gcgaacgacaaggcgatgggcggcgtgcgctcggacaagcagcgcgacgcgaccgacggc
tacgacggcggctgggtcgcgcacccgggcctcgtgccgatcgcgatggaagagttcgtc
aaggtactccgcgacaagccgaaccagatcgcgaagcagcgcgacgacgtgcaggtcgaa
ggcaggaacctgctcgacttccagccggaagcgccgatcaccgaagcgggcctgcgcaac
aacatcaacgtcgggatccactatctcggcgcgtggctcgacggcaacggctgcgtgccg
atccacaacctgatggaagatgcggcgacggccgagatttcccgctcgcaggtgtggcaa
tggatccgctcgccgaagggcgtgctcgacgacggccgcaaggtcacggccgaactcgtg
cgcgaattcgcgaagatcgaactggacaacgtgaagcgcgcggtcggcggcaacacgcaa
ccgtacgagcgcgccgcggcgatcttcgagcagatgtcgacgtcggaaggcttcaccgaa
ttcctgacgctgccgctgtacgaggaaatctga

DBGET integrated database retrieval system