KEGG   Burkholderia cenocepacia AU1054: Bcen_6045Help
Entry
Bcen_6045         CDS       T00363                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bcn01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bcn00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
3:complement(635654..636793)
Genome map
AA seq 379 aa AA seqDB search
MSATLALTEQLIARASVTPDDQHCQQIMTERLAALGFECETIASHGVTNLWAVKRGTDGR
DGKLLAFAGHTDVVPTGPLEQWTSPPFVPAHRDGKLYGRGAADMKTSLAAFVVASEEFVA
AHPDHRGAIAFLITSDEEGPATDGTVKVVELLQERGERLDYCIVGEPTSTAELGDVVKNG
RRGSMSGELVIKGVQGHIAYPHLAKNPIHLLAPALAELAAEQWDAGNEYFPPTTWQVSNL
HAGTGATNVIPGHADLLFNFRFSTASTVEGLQARVHAILDKHGLEYTLKWSVSGLPFLTP
RGELSGALEHAIRTETGITTELSTTGGTSDGRFIARICPQVIEFGPPNGSIHKIDEHIEV
RFVDPLKNVYRRALEQLIA
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccaccctagcccttaccgaacagctgatcgcccgcgcgtccgtgacgcccgac
gaccagcactgccagcagatcatgaccgagcgcctcgccgcgctcggcttcgaatgcgag
accatcgcgtcgcacggcgtgaccaacctgtgggccgtcaagcgcggcaccgacggccgc
gacggcaagctgctcgcgttcgcgggccataccgacgtcgtgccgaccggcccgctcgaa
cagtggacctcgccgccgttcgtccccgcccatcgcgacggcaagctgtacggccgcggc
gcggccgacatgaagacgtcgctcgcggcgttcgtcgtcgcctccgaggaattcgtcgcg
gcgcatccggaccaccgcggcgcgatcgcgttcctgatcacgagcgacgaggaaggcccg
gccaccgacggcaccgtgaaggtcgtcgagctgctgcaggaacgcggcgagcggctcgac
tactgcatcgtcggcgagccgacgtcgaccgccgagctcggcgacgtcgtcaagaacggc
cgccgcgggtcgatgtccggcgaactggtcatcaagggcgtgcaaggccacattgcctat
ccgcacctcgcgaagaacccgatccacctgctcgcgccggcgctcgccgagctcgccgcc
gagcaatgggacgccggcaacgaatacttcccgccgaccacctggcaggtgtcgaacctg
cacgctggcaccggcgcgaccaacgtgatcccgggccacgccgacctgctgttcaacttc
cgcttctcgaccgcgagcaccgtcgaaggcctgcaggcccgcgtgcacgcgatcctcgac
aagcacggcctcgaatacacgctgaagtggtcggtgagcggcctgccgttcctcacgccg
cgcggtgaactgtcgggcgcgctggaacacgcgatccgcaccgagaccggtatcacgacc
gagctgtcgacgacgggcggcacgtcggacggccgcttcattgcgcgcatctgcccgcag
gtgatcgagttcggcccgccgaacggcagcatccacaagatcgacgagcacatcgaagtg
cgcttcgtcgacccgctgaagaacgtgtaccgacgcgcgctcgaacaactgatcgcctga

DBGET integrated database retrieval system