KEGG   Burkholderia cenocepacia AU1054: Bcen_6064Help
Entry
Bcen_6064         CDS       T00363                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00900  Terpenoid backbone biosynthesis
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcen_6064
Enzymes [BR:bcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Bcen_6064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Semialdhyde_dh
Motif
Other DBs
NCBI-ProteinID: ABF80929
JGI: Bcen6064
UniProt: Q1BHH6
Position
3:660309..661505
Genome map
AA seq 398 aa AA seqDB search
MQKRLTLLGSTGSIGDSTLDVVARHPERFSVYALTAHRNGDKLVEQCLRFAPEVAVVGDA
ATAAHVDAKLRAAGSKTVVLHGPQALVDVSKSDGCDTVVAAIVGAAGLAPSLAAARAGKR
ILLANKEALVMSGAIFMDAVRDHGAILLPVDSEHNAIFQCMPRDAAEHGGISKIILTASG
GPFRTREPATLVDVTPDEACKHPNWVMGRKISVDSATMMNKGLEVIEAHWIFGLPGDRID
VLIHPQSVIHSLVSYRDGSVLAQLGNPDMRTPIAHALAFPERVDAGVDQLDLAQIAQLSF
EKPDYARFPCLALALKALEEGGIASAALNAANEVAVEAFLERRIGFMAIAATVDAVLNTL
PNRAPDGLDDVLAADAEARRLAAAIIAKAPAPRVERTV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacgtctgacattgctcggttccacgggctcgatcggagacagcacgctcgac
gtggtcgcgcgccatcccgagcgcttctcggtctacgcgctgaccgcgcaccgcaacggc
gacaagctcgtcgagcagtgtctgcgcttcgcgcccgaagtggcggtggtcggcgatgcc
gcaaccgccgcgcacgtcgacgcgaaactgcgcgcggcgggcagcaagacggtcgtgctg
cacgggccgcaggcgctcgtcgacgtgtcgaagagcgacggctgcgacacggtggtcgcg
gcgatcgtcggcgcggccggcctcgcgccgagcctggcggccgcccgcgccggcaagcgg
atcctgctcgcgaacaaggaagcgctcgtgatgtcgggcgcgatcttcatggacgccgtg
cgcgaccatggcgcgatcctgctgccggtcgacagcgagcacaacgcgatcttccagtgc
atgccgcgcgacgcggccgagcacggcgggatctcgaagatcatcctgaccgcgtcgggc
gggccgttccgcacgcgtgaaccggccacgctcgtcgacgtgacgccggacgaggcatgc
aagcacccgaactgggtgatgggccgcaagatctcggtcgattccgcgacgatgatgaac
aagggcctcgaggtgatcgaggcgcactggatcttcgggctgccgggcgaccggatcgat
gtgctgatccatccgcagagcgtgatccattcgctcgtgtcgtaccgcgacggctcggtg
ctcgcgcagctcggcaaccccgacatgcgcacgccgatcgcccacgcgctcgcattcccc
gagcgcgtcgatgcgggcgttgaccagctcgacctcgcgcagatcgcccagctgtcgttc
gagaagcccgattacgcgcgcttcccgtgcctcgcgctcgcgctgaaggcactcgaggaa
ggcggtatcgcgagcgccgcattgaacgcggcgaacgaagtggcggtcgaagcatttctc
gagcgccggatcggcttcatggcgatcgcggcgacggtcgacgccgtgctcaacacgctg
ccgaaccgcgcgcccgacgggctcgacgacgtcctcgcggcggatgccgaggctcgccgc
ctcgccgccgcgatcattgcgaaagcgcctgcgccacgcgtggagcgtactgtctga

DBGET integrated database retrieval system