KEGG   Burkholderia cenocepacia AU1054: Bcen_6160Help
Entry
Bcen_6160         CDS       T00363                                 

Definition
lipolytic enzyme, G-D-S-L
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bcen_6160
Enzymes [BR:bcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bcen_6160
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bcen_6160
Lipid biosynthesis proteins [BR:bcn01004]
 Fatty acid synthase
  Component type
   Bcen_6160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
3:complement(760095..760649)
Genome map
AA seq 184 aa AA seqDB search
MIVVLGDSLSAEYGLPRDTGWVALLRQRLTTERIDYSVANASVSGDTTSGGRARLPAVLQ
RLKPSIVVVELGSNDALRGVPLATTEQNLRDIIASAQRARAKVVLVGMYVPPNYGPDYTQ
KFHAVYTRLSKDLGVPLVPFLLAGIENKPELFQADQMHPAQQAQGILLDNVWPALKPLLG
KPRG
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcgtcctcggcgacagtctctcggccgaatacggcttgccgcgcgacaccggc
tgggtggcgttactgcggcaacggctcacgaccgagcgaatcgattatagcgtcgcgaac
gccagcgtcagcggcgacaccacgagcggcggccgtgcgcggctgcccgcggtgctgcag
cggctcaagccgtcgatcgtcgtcgtcgaactcggctcgaacgacgcgctgcgcggcgta
ccgctcgcgacgaccgagcagaacctgcgcgacatcatcgccagcgcgcagcgcgcgcgg
gcgaaggtcgtgctggtcggcatgtacgtgccacccaattacggccccgactacacgcag
aagttccacgcggtctatacgcggctgtcgaaagacctcggcgtgccgctcgtgccattc
ctgctggccggcatcgagaacaagcccgagctgttccaggccgaccagatgcatcccgcg
cagcaggcgcagggcatcctgctcgacaatgtgtggccggcactgaagccgttgctcggc
aagccgcgcggctga

DBGET integrated database retrieval system