KEGG   Burkholderia cenocepacia AU1054: Bcen_6174Help
Entry
Bcen_6174         CDS       T00363                                 

Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bcn00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
3:779271..779903
Genome map
AA seq 210 aa AA seqDB search
MKRTDDVLLVIDVQYDFMPGGALAVPDGDAVVPVINALAQRFDQVVLTQDWHPRERVSFA
ANHPGREPFSTLALPYGEQVLWPVHCVQDTDGAALHRDLDIPHARLVIRKGGDAQVDSYS
AFVEADRTTRTGLAGYLRELGAKRVWCCGLATDYCVAWSALDARAAGFEAAVINDACRAI
DLNGSLAHAWQQMQAAGVVHATSAGARPAA
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcaccgacgacgtcctgctcgtgatcgacgtgcaatacgacttcatgccgggc
ggcgcgctcgcggtgcccgacggcgatgcggtcgtgccggtgatcaacgcgctcgcgcaa
cgcttcgaccaggtcgtgctcacgcaggactggcacccgcgcgagcgcgtgtcgttcgcg
gcgaaccatccgggccgcgagccgttctcgacgctcgcgctgccgtacggcgagcaggtg
ctgtggcccgtgcactgcgtgcaggacaccgacggcgcggcgctgcatcgcgacctcgac
atcccgcacgcgcggctcgtgatccgcaagggcggcgacgcgcaggtcgacagctattcc
gcgttcgtcgaagccgaccgcacgacacgcacggggctcgcgggctatctgcgcgaactc
ggggcgaagcgcgtgtggtgctgcgggctcgcgaccgactattgcgtcgcgtggtcggcg
ctcgatgcgcgcgcggccggtttcgaagccgcggtgatcaacgatgcgtgccgtgcgatc
gacctgaacgggtcgctcgcgcacgcatggcagcagatgcaggcagcgggcgtcgtgcat
gcgacgtccgcgggcgcgcgcccggcggcgtag

DBGET integrated database retrieval system