KEGG   Burkholderia cenocepacia AU1054: Bcen_6226Help
Entry
Bcen_6226         CDS       T00363                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bcen_6226
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bcen_6226
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bcen_6226
Enzymes [BR:bcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bcen_6226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3:832872..834323
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPAEYPKVSADELARWRTLSYADLAFEI
LSKFCDDVPADDLRAITRRTYTAAVYSNTRHGENASDITPLKTLGTEHGTALSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGEALNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
KKMSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATRSNDERVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGAYRVRSAEHTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVEEKG
GFDLAASGDFARVAEFGFVSGRSSHTDRIATIRDVFSRYDTMIDTHTADGVKVAREHLEA
GVPMVVLETAQPIKFGETIREALDREAERPAAFDGLEALPQRFEVVKADAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctccacgcgcggcgccggcatcggcgagcgccatacgttctccgacatc
ctgctcggcggtctcgcgaaggacggcggcctctacctgccggccgagtatccgaaggtg
tccgccgacgagctcgcgcgctggcgcacgctgtcgtacgcggatctcgcgttcgagatc
ctgtcgaagttctgcgacgacgtgccggccgacgacctgcgcgcgatcacgcgccgtacc
tacacggctgccgtgtacagcaacacgcgccacggcgagaacgcatccgacatcacgccg
ctgaagacgctcggcaccgagcacggcacggcgctgtcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagttgctcggcaacctgttcgagtacacg
ctcgcgaagcacggcgaagcgctgaacatcctcggcgcgacgtcgggcgacaccggcagc
gcggccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagacggcgcagatgttcagcctgcaggacccgaacatcttc
aacctcgcggtcgaaggcgtgttcgacgactgccaggacatcgtgaaggccgtgtcgaac
gatcacgcgttcaaggcgcagcagaagatcggcaccgtcaactcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgcggtcgaacgac
gagcgcgtgtcgttcacggtgccgtcgggcaacttcggcaacgtctgcgcgggccacatc
gcgcggatgatggggctgccgatcgcgaagctggtggtcgcgaccaacgagaacgacgtg
ctcgacgaattcttccgcaccggcgcgtatcgcgtgcgcagcgccgagcacacctatcac
acgagcagcccgagcatggacatctcgaaggcatcgaacttcgagcgcttcgtgttcgac
ctgctcggccgcgatccggcgcgcgtgatgcaactgttccgcgacgtcgaggagaagggc
ggcttcgatctcgcggcgagcggcgatttcgcgcgcgtggccgaattcggtttcgtgtcg
ggccgcagcagccacaccgaccgcatcgcgacgatccgcgacgtgttctcgcgctacgac
acgatgatcgatacgcatacggccgacggcgtgaaggtcgcgcgcgagcatctggaggcc
ggcgtgccgatggtcgtgctcgagacggcgcagccgatcaagttcggcgagacgatccgc
gaagcgctcgatcgcgaagccgagcggccggccgccttcgacgggctcgaggcgctgccg
cagcgcttcgaggtcgtgaaggccgacgcgcagcaggtgaaggacttcatcgccgcccat
acgggcgcatga

DBGET integrated database retrieval system