KEGG   Burkholderia cenocepacia AU1054: Bcen_6242Help
Entry
Bcen_6242         CDS       T00363                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
bcn00010  Glycolysis / Gluconeogenesis
bcn00020  Citrate cycle (TCA cycle)
bcn00620  Pyruvate metabolism
bcn01100  Metabolic pathways
bcn01110  Biosynthesis of secondary metabolites
bcn01120  Microbial metabolism in diverse environments
bcn01130  Biosynthesis of antibiotics
bcn01200  Carbon metabolism
Module
bcn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_6242
   00020 Citrate cycle (TCA cycle)
    Bcen_6242
   00620 Pyruvate metabolism
    Bcen_6242
Enzymes [BR:bcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcen_6242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Biotin_lipoyl Thioesterase Abhydrolase_5 PGAP1 Ndr Esterase Ser_hydrolase DUF915 DUF900 Abhydrolase_3 FSH1 LIDHydrolase Lipase_3 DUF676
Motif
Other DBs
NCBI-ProteinID: ABF81106
JGI: Bcen6242
UniProt: A0A0H2Y1A7
Position
3:849654..850769
Genome map
AA seq 371 aa AA seqDB search
MSIHMITMPKWGLSMEQGQVNGWLKAVGERVAKGDEVLDVETDKISSGVECAFDGTLRRQ
VAQEGETLPVGALLGVVAAAEASDADIDAAIADFQRDFVPSAASDEAAGPQPEKAQIGGR
TVRFLKLGEGSGTPAVLIHGFGGDLNNWLFNHAELAAHRPVWALDLPGHGESGKAVETGS
LDELADAVLALLDAQHIERAHLIGHSMGGAVAMTVAERAPQRVASLTLIASAGLGTDINR
AYIDGFVAGNSRNTLKPHLGALFADDALVTRQLVEDLVKYKRLEGVQAALEKIAHAAFDG
AAQRRVFRDRLATLAPRTLVIWGERDQVIPAQHAQGLPDGVRAEVIAGSGHMVQMEAAAD
VNRLIVAFLGD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcacatgatcacgatgcccaaatgggggctgtcgatggagcaggggcaggtc
aacggctggctgaaggcggtcggcgaacgcgtggcgaagggcgacgaagtgctcgacgtc
gagaccgacaagatctcgtcgggtgtcgaatgcgcattcgacggcacgctgcgccggcag
gtcgcgcaggagggcgagacgctgcccgtcggcgcgctgctcggtgtcgtcgcggccgcc
gaggcgagcgatgccgacatcgacgcggcgatcgccgatttccagcgcgatttcgtgccg
agcgcggcgtccgacgaggcggccggcccgcagccggagaaggcgcagatcggcggccgc
acggtccgcttcctgaagctgggcgaggggtcgggcacgcccgccgtgctgatccacggc
ttcggcggcgacctgaacaactggctgttcaaccacgcggagctcgccgcgcaccggccg
gtgtgggcgctcgatctgcccggccacggcgaatcgggcaaggcggtcgagaccggcagc
ctcgacgaactggccgacgcggtgctcgcgctgctcgatgcgcagcacatcgagcgcgcg
cacctgatcggccattcgatgggcggggcggtcgcgatgacggtggccgagcgcgcaccg
caacgcgttgcatcgctcacgctgatcgcgagcgcggggctcggcaccgacatcaaccgc
gcgtacatcgacggcttcgtcgccggcaacagccgcaacacgctgaaaccgcacctcggc
gcgctgttcgcggacgacgcgctggtcacgcggcaactcgtcgaggacctcgtcaagtac
aagcggctcgaaggcgtgcaggccgcgctggagaagatcgcgcacgccgcgttcgacggc
gccgcgcagcggcgtgtgttccgtgaccggctcgcgacgctggcgccgcgcacgctcgtg
atctggggcgagcgcgaccaggtgattcccgcgcagcatgcgcagggcttgccggacggc
gtgcgtgccgaggtgatcgccggcagcgggcacatggtgcagatggaagcggccgccgac
gtgaaccgcctgatcgtcgcgttcctcggagactga

DBGET integrated database retrieval system