KEGG   Burkholderia cenocepacia AU1054: Bcen_6242Help
Entry
Bcen_6242         CDS       T00363                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bcen_6242
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bcen_6242
   00020 Citrate cycle (TCA cycle)
    Bcen_6242
   00620 Pyruvate metabolism
    Bcen_6242
Enzymes [BR:bcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bcen_6242
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
3:849654..850769
Genome map
AA seq 371 aa AA seqDB search
MSIHMITMPKWGLSMEQGQVNGWLKAVGERVAKGDEVLDVETDKISSGVECAFDGTLRRQ
VAQEGETLPVGALLGVVAAAEASDADIDAAIADFQRDFVPSAASDEAAGPQPEKAQIGGR
TVRFLKLGEGSGTPAVLIHGFGGDLNNWLFNHAELAAHRPVWALDLPGHGESGKAVETGS
LDELADAVLALLDAQHIERAHLIGHSMGGAVAMTVAERAPQRVASLTLIASAGLGTDINR
AYIDGFVAGNSRNTLKPHLGALFADDALVTRQLVEDLVKYKRLEGVQAALEKIAHAAFDG
AAQRRVFRDRLATLAPRTLVIWGERDQVIPAQHAQGLPDGVRAEVIAGSGHMVQMEAAAD
VNRLIVAFLGD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcacatgatcacgatgcccaaatgggggctgtcgatggagcaggggcaggtc
aacggctggctgaaggcggtcggcgaacgcgtggcgaagggcgacgaagtgctcgacgtc
gagaccgacaagatctcgtcgggtgtcgaatgcgcattcgacggcacgctgcgccggcag
gtcgcgcaggagggcgagacgctgcccgtcggcgcgctgctcggtgtcgtcgcggccgcc
gaggcgagcgatgccgacatcgacgcggcgatcgccgatttccagcgcgatttcgtgccg
agcgcggcgtccgacgaggcggccggcccgcagccggagaaggcgcagatcggcggccgc
acggtccgcttcctgaagctgggcgaggggtcgggcacgcccgccgtgctgatccacggc
ttcggcggcgacctgaacaactggctgttcaaccacgcggagctcgccgcgcaccggccg
gtgtgggcgctcgatctgcccggccacggcgaatcgggcaaggcggtcgagaccggcagc
ctcgacgaactggccgacgcggtgctcgcgctgctcgatgcgcagcacatcgagcgcgcg
cacctgatcggccattcgatgggcggggcggtcgcgatgacggtggccgagcgcgcaccg
caacgcgttgcatcgctcacgctgatcgcgagcgcggggctcggcaccgacatcaaccgc
gcgtacatcgacggcttcgtcgccggcaacagccgcaacacgctgaaaccgcacctcggc
gcgctgttcgcggacgacgcgctggtcacgcggcaactcgtcgaggacctcgtcaagtac
aagcggctcgaaggcgtgcaggccgcgctggagaagatcgcgcacgccgcgttcgacggc
gccgcgcagcggcgtgtgttccgtgaccggctcgcgacgctggcgccgcgcacgctcgtg
atctggggcgagcgcgaccaggtgattcccgcgcagcatgcgcagggcttgccggacggc
gtgcgtgccgaggtgatcgccggcagcgggcacatggtgcagatggaagcggccgccgac
gtgaaccgcctgatcgtcgcgttcctcggagactga

DBGET integrated database retrieval system