KEGG   Burkholderia cenocepacia AU1054: Bcen_6254Help
Entry
Bcen_6254         CDS       T00363                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bcn  Burkholderia cenocepacia AU1054
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcen_6254 (recR)
DNA repair and recombination proteins [BR:bcn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bcen_6254 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
3:863776..864372
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAVHLMQHDREGAERLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDEERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccgtccgccttgtccgctctcgtcgaagcgttgcgcgtgctgcccggtgtc
gggccgaaatccgcgcagcgcatggcggttcacctgatgcagcacgaccgtgagggcgcg
gagcggctcggccggtcgctgctgttcgcgaccgagcacctgcagcactgcgagaagtgc
aacacgttcaccgaggcgcagatctgcgaggtctgcagcgacgaggagcgtgatccgacg
ctgctgtgcgtcgtcgagacgcctgccgaccagatcatgctcgagcagacgatgacctac
cgcgggctgtatttcgtgctgatgggccgactgagcccgctcgacggaatcggtccgaag
gaaatccatttcgaccgcctcgtgcggcgcgcgtcggacggcgtcgtcaaggaggtcgtg
ctcgcgaccaacttcacgaacgaaggcgaagccaccgcccactacctcggacagacgctc
aaggcgcgcgggctggcggtcacgcgcctcgcgcgcggcgtgccggtgggcggcgagctc
gagtacgtcgacgcgggcaccatcgcccgcgcaatgctcgatcgtcgcacgatgtaa

DBGET integrated database retrieval system