KEGG   Burkholderia cenocepacia AU1054: Bcen_6257Help
Entry
Bcen_6257         CDS       T00363                                 

Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bcn  Burkholderia cenocepacia AU1054
Brite
Enzymes [BR:bcn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Bcen_6257
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
JCVI-Pathema: 
UniProt: 
Position
3:866605..867537
Genome map
AA seq 310 aa AA seqDB search
MSGERAKRFPLALEDLKRAPRKSEGRPGERQTAGAVPKAADKPAAVLKPVAVKPAAVRAP
LPGIAAAKPATAPKPTALKPALPKPAAPSIAPAGAFALTSERVRERMVERLRANGVTDAR
VLDAMAAVPRHLFVDPGLATQAYEDSALPIGHQQTISKPSVVARMIELAMAGRTLERVLE
IGTGCGYQAAVLSHVARDVYSIERIKPLYERAKLNLRPLRVPNIRLHYGDGRVGLPSAAP
FDAIVIAAAGLDVPQALLEQLAIGGRLVAPVGAQSGQHQVLTLVERVAHAQWRESRLDRV
FFVPLKSGVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggttcccgctcgcgctcgaagatctcaagcgagcgcca
cgcaagtcggaaggtcggcccggtgaacgccagacggcgggggcggtgccgaaggctgcc
gacaaacccgcggccgtgctgaagccggttgcggtgaagccggccgccgtgcgggcgccg
ctgccgggtatcgccgccgcgaagccggcgaccgcaccgaagcccaccgcgctgaagcct
gcgctgccgaagccggccgcgccgagcatcgcgccggccggcgcgttcgccctcacgtcg
gaacgtgtgcgcgagcggatggtcgaacgcctgcgcgcgaacggcgtgaccgatgcgcgc
gtgctggacgcaatggccgcggtgccgcgccacctgttcgtggatcccgggctcgcgacg
caggcctacgaggattcggcattgccgatcggccatcagcagaccatttcaaagccgtcg
gtcgtcgcgcgcatgatcgagctcgcgatggccggccgcaccctcgagcgcgtgctcgag
atcggcacgggttgcggctatcaggccgccgtgctgagtcacgtggcacgcgacgtgtat
tcgattgaacgcatcaagccgctttacgagcgcgcgaagctgaacctgcggccgctgcgc
gtgccgaacatccgtctgcactacggcgacgggcgtgtcggcttgccgtccgcggccccg
ttcgacgcgatcgtgatcgcggcggcggggctcgacgtgccgcaggcgctgctcgagcag
ctcgcgatcggcgggcggctcgtcgcgccggtcggcgcgcagagcgggcagcaccaggtg
ctcacgctcgtcgagcgcgtcgcgcacgcgcaatggcgagagtcccggcttgatcgcgtt
ttctttgtccctttaaaatccggagtgatttga

DBGET integrated database retrieval system