KEGG   Burkholderia cenocepacia AU1054: Bcen_6286Help
Entry
Bcen_6286         CDS       T00363                                 

Definition
(GenBank) ribosomal large subunit pseudouridine synthase D (EC:5.4.99.-)
  KO
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
bcn  Burkholderia cenocepacia AU1054
Brite
Enzymes [BR:bcn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     Bcen_6286
Ribosome biogenesis [BR:bcn03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    Bcen_6286
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3:899507..900715
Genome map
AA seq 402 aa AA seqDB search
MTRSSSQNAQPGTPNREDYSPSDRPADAASGDSLDDDLAGDAMQPPVVPSAAVDEAPRVV
EVPLSLAGERLDKALAQLFPEFSRSRLQSWIEAQRVLVDGAPAKIRQPVPLGAKIALVPD
LLPEQLAFTPEPVPLDVIYEDDALVVINKPAGLVVHPAAGNWSGTILNGLLHRYGDAAAG
LPRAGIVHRLDKETSGLMVVARTLAAQTDLVRQLQARTVKRRYFALVWGTMPEEGTIDAP
IGRDPRERTRMAVVTGASGKPARTHFRTVDTCLWQRQPVSAIQCDLETGRTHQIRVHCAH
AGHPLLGDPVYGRARGKRSVTPLPDGFARQALHAWRLGLVHPVTGKAMQWRCPLPDDMNT
LVAALGFGQGDEEFDDDDGVYDDDDFGGEYHDDEPYLDDEEE
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacccgttcaagttcgcagaatgcccagccgggcacaccaaatcgcgaagattatagc
ccaagcgatcggcccgccgacgctgcgtcgggggattccctcgatgacgatctggccggc
gacgcgatgcagccgcccgtcgtgccgtccgcggcggtcgacgaggcgccgcgcgtcgtc
gaagtgccgctgtcgctcgcgggtgaacgcctcgacaaggcgcttgcccaactgttcccc
gaattctcgcgcagccgcctgcagagctggatcgaggcgcagcgcgtgctcgtcgacggc
gcgccggcgaagatccgtcagccggtgccgctcggcgcgaagatcgcgctcgtgcccgat
ctgttgcccgagcagctcgcgttcacgccggagcccgtgccgctcgacgtgatctacgag
gacgacgcactcgtcgtcatcaacaagccggccggcctcgtcgtgcatccggccgccggc
aactggagcggcacgatcctcaacggtctgctgcatcgctacggcgacgcggccgccggc
ctgccgcgcgcggggatcgtccaccggctcgacaaggaaacctccggcctgatggtggtc
gcccgcacgctggccgcgcagaccgacctcgtgcgtcagctgcaggcccgcacggtgaag
cgccgctatttcgcgctcgtgtggggcacgatgcccgaggagggcacgatcgacgcgccg
atcggccgcgatccgcgcgaacgcacgcgcatggccgtcgtcaccggcgcgtcgggcaag
cccgctcgcacgcatttccgcacggttgacacatgcctgtggcaacgtcagccggtttcg
gcgattcagtgcgatctcgaaaccggccgcacgcaccagatccgcgtgcactgcgcgcac
gccgggcatccgctgctcggcgatccggtctacgggcgtgcgcgcggcaagcgctcggtc
acgccgctgccggacgggttcgcacgacaggcgctgcatgcgtggcggctcggcctcgtg
catccggtcacgggcaaggcgatgcagtggcgctgcccgctgccggacgacatgaacacg
ctggtcgccgcgctgggcttcgggcagggcgacgaggaattcgacgacgacgacggtgtc
tacgacgatgacgacttcggcggcgagtatcacgacgacgagccgtacctggacgacgag
gaggagtga

DBGET integrated database retrieval system