KEGG   Bacillus cellulosilyticus: Bcell_0025Help
Entry
Bcell_0025        CDS       T01389                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bco  Bacillus cellulosilyticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bco00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bcell_0025
DNA repair and recombination proteins [BR:bco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bcell_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
37276..37872
Genome map
AA seq 198 aa AA seqDB search
MQYPQPISKLIEGFMRLPGIGPKTAARLAFYVLDMREDDVLDFAKALVNAKRQLTYCSVC
HHITDIDPCRICEDNGRDQTVLCVVQESKDVIAMEKMKEYTGLYHVLHGCISPVDGIGPE
DIYIPDLLKRLQDDTIQEVIIATNPNIEGEATAMYISRLIKPTGLKVTRIAHGLPVGGDL
EYADEVTLSKAIEGRREI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagtaccctcaaccgatatcgaagttaatagaagggtttatgcgattacctggaatt
ggtcctaaaacagctgctaggctagcgttttatgtattagatatgagagaagacgacgta
ttagactttgcaaaagcattagttaatgcgaagcgacaattaacttattgttccgtttgc
catcatattacagacatagacccgtgtagaatatgtgaggataatggacgagatcaaacg
gtgctatgcgttgtacaggaatcgaaagatgttatcgcgatggaaaaaatgaaggaatat
actggtttatatcatgtgctacatggctgtatatctccagttgatggaataggaccagaa
gatatttacattcctgacttattgaaaagactacaagatgatacgattcaagaagtaatt
attgcaacaaaccccaacattgaaggtgaagctacggcaatgtatatttcaaggttaata
aagccaaccggattaaaggtaacgagaattgcgcatggtttacctgtagggggagacctc
gagtatgcagatgaagtaacgttatccaaggcgatagagggtagaagagaaatctaa

DBGET integrated database retrieval system