KEGG   Bacillus cellulosilyticus: Bcell_0077Help
Entry
Bcell_0077        CDS       T01389                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bco  Bacillus cellulosilyticus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bco00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
95961..96803
Genome map
AA seq 280 aa AA seqDB search
MTFNKVMEWQGYRLDFNTKTYVMGILNVTPDSFSDGGKYGEESFAVKHALSMIETGADII
DVGGESTRPGASKVAEEEELRRVLDPIKAVSEVVQVPISIDTYKASVAEKAIQAGASIIN
DVWGAKADDNMAAVAAHYDVPIILTHNREKADYNNFIEDVIRDLEESISLCLNAGVSDSK
IILDPGVGFAKTYEQNVLVMRHLEKISEMGYPVLLGTSRKSLIAKTLDLPVNERVEGTGA
TVCLGITKGTNIVRVHDVLEMSRMVKMMDVMIGKAQLPNV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaataaagtaatggaatggcaaggatatcgactagattttaatacaaagact
tatgtaatgggtattttaaatgtaacccccgactctttttccgatggtggaaagtatgga
gaagagtcatttgcagtaaaacatgctttatcaatgatagaaactggagcggatattatt
gatgttgggggagagtctacacgacctggtgcaagcaaagtagcagaagaagaggaatta
cgccgtgtgcttgacccaattaaagcagtcagcgaagtggtacaagttccaatctctatt
gatacatacaaagcatctgttgcagaaaaagccattcaggctggtgcaagtatcatcaat
gatgtttggggagcaaaggcagatgataacatggcagctgttgctgctcattatgatgtt
ccgattatacttacgcacaaccgcgagaaagccgattacaacaactttatagaagacgtc
attagagacttagaggagagtatttcattatgtctgaatgctggtgtatctgatagcaaa
atcatactcgatcctggagtcggttttgcaaaaacgtatgagcaaaatgtacttgtgatg
cgtcatctagagaaaatctctgaaatgggatatccagtattgttaggtacatcaagaaaa
tcgttaattgcgaaaacgttggacttgcctgttaatgaacgcgtcgaaggtactggtgca
acagtgtgtttagggataacaaaagggacaaatatcgtaagggtacatgacgtgctagag
atgagtagaatggtaaaaatgatggatgttatgattgggaaagcacaattgccaaacgta
taa

DBGET integrated database retrieval system