KEGG   Bacillus cellulosilyticus: Bcell_0163Help
Entry
Bcell_0163        CDS       T01389                                 

Definition
(GenBank) spore germination protein GerD
  KO
K06294  
spore germination protein D
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(180753..181439)
Genome map
AA seq 228 aa AA seqDB search
MWYYHNKYKRVPQWHRYFEKVINNISLKKAVVYIPLLFILLLNGCAAMEDNSSQQPDYES
TKKMMVDMLKTDEGKQAIQDVLQDEEVRQNLVMEEDYVKQTIQTTLTSDEGKEYWQRVMQ
DPEFAKSFAESIQSQNEKMMKSLMKDPEYQGMMMDVLKDPEMEEKYLELMQSKEYRQQVM
TVMQDAFESPYFVAKLNDIFSNVAEEQMNKQDQEQQEEGQDSGESEEE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
gtgtggtattatcataataaatataaacgtgttccacaatggcaccgatattttgaaaaa
gttattaataacatttccttgaagaaggccgttgtttatataccgctacttttcatcttg
ttgttaaatggctgtgcagctatggaggataatagctctcagcagccagattacgaaagc
acaaaaaaaatgatggtagatatgttaaaaacagatgaagggaaacaagccattcaagat
gtacttcaagatgaggaagttcgtcaaaaccttgttatggaagaggattatgtcaaacaa
acgattcagactacactaacctccgatgaaggaaaagaatattggcaaagagtcatgcaa
gatcctgaatttgcaaaatcatttgctgagagtattcaaagtcaaaatgaaaagatgatg
aaaagcttaatgaaggatcctgaatatcagggcatgatgatggacgtattaaaggatcct
gaaatggaagaaaagtatttagaattaatgcaaagtaaggagtaccgtcaacaagtgatg
acagtcatgcaagatgcttttgaaagcccttattttgtagctaaactaaatgacattttc
tctaatgtcgctgaagagcaaatgaataaacaagatcaagaacaacaagaagaaggtcaa
gatagtggcgaaagtgaagaggaataa

DBGET integrated database retrieval system