KEGG   Bacillus cellulosilyticus: Bcell_0165Help
Entry
Bcell_0165        CDS       T01389                                 

Definition
(GenBank) polysaccharide deacetylase family sporulation protein PdaB
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(182377..183135)
Genome map
AA seq 252 aa AA seqDB search
MNFIWVWNAKTLKRYAIIAVAALFTAGILFVERSQIPVFSTDDQPVAIYKVDAEEKEVAL
TFNVSWGEERALPILDTLKEHDVTSTFFVSADWAERHPEIVERIVEDGHELGSHGYVHEH
YTKKDDEQIKKDIQTAHRIIQEVSQEVPNLLRPPNGSFDERVLSIAENQNYDVIHWSVDS
NDWQNPGVDTIVENVTRNISNGDIVLMHASDSAKQTNEALAEIISYIESEGYHFNTVSEL
VSGAEVVTKEVQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgaattttatttgggtatggaatgctaaaacattaaaaagatatgctatcattgcggtt
gctgcacttttcactgctgggatcctatttgtagaacgctcacaaatacctgttttttct
actgatgatcagcctgttgctatctataaagttgatgcagaagagaaagaagttgccctt
acttttaacgtaagctggggagaagaacgtgcattacctattttagatacgctgaaagag
catgatgtaacatcgacatttttcgtttcagctgattgggcagagaggcacccagaaata
gtagaaagaattgtagaggacggtcatgaattaggaagtcatggctatgttcacgagcac
tatacgaaaaaagatgatgaacagattaaaaaagacattcaaacagcacatcgaatcatt
caagaagtaagtcaagaagtccctaatctattaagacctccaaatggtagttttgacgag
cgagttttgtctattgcggaaaatcaaaattacgatgtcattcactggagtgtggattca
aatgactggcaaaaccctggtgtagatacgatcgttgaaaatgttactcgtaacatttca
aacggagatatcgttcttatgcacgcctctgattcagctaaacaaacaaatgaagcattg
gcagagatcatttcctacatcgaaagtgaaggatatcattttaataccgtttctgaactc
gtctcaggagctgaagttgtaacaaaagaagtccaataa

DBGET integrated database retrieval system