KEGG   Bacillus cellulosilyticus: Bcell_0166Help
Entry
Bcell_0166        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
183261..183503
Genome map
AA seq 80 aa AA seqDB search
MLGMMLTGKESQEIEYLLKRELEELLLDFSDSRIDGVVKRAMEERYQMIFQLYKRFTTKQ
EYLKYVRNRQYTEYKTSQSD
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgcttggtatgatgttaacaggtaaagaatcgcaggagattgaatacttactaaagaga
gagctagaagaacttttacttgatttttctgattcacgtattgatggggttgttaaaaga
gcgatggaagaaagataccaaatgatttttcagctttataagcgttttacaacaaagcaa
gaatatttaaagtacgttaggaatcgtcaatacacagaatataaaacatctcaatctgat
taa

DBGET integrated database retrieval system