KEGG   Bacillus cellulosilyticus: Bcell_0168Help
Entry
Bcell_0168        CDS       T01389                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  
RNA polymerase sigma-70 factor, ECF subfamily
Organism
bco  Bacillus cellulosilyticus
Brite
Transcription machinery [BR:bco03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Bcell_0168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
186205..186768
Genome map
AA seq 187 aa AA seqDB search
MDAVVKKIVIEVKKGNQQAFSELVELYKDKVYQIAYRMLGNVHEAQDVAQEAFLRAYVNI
ESYDTNRKFSTWLFRIATNLAIDRIRKKKPDFHLEDKVAGTEDLDYYSQFATEDKLPEEK
VVQYETQDWVQKEIMALPPKYRSAIILKYIEDLSLKEISNILNLPVATVKTRIHRGREAL
RKRLRET
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggatgcggttgtaaaaaaaatagttatagaagtaaagaaaggtaatcaacaagctttc
tcagagctagttgagctatataaagataaagtttatcaaattgcatatcgaatgctaggg
aatgtgcatgaggcgcaggatgttgctcaagaagcgtttttacgtgcatatgtgaatatt
gagtcgtatgatacaaataggaagttttcaacttggctttttaggattgcaacaaactta
gctatcgatagaattagaaagaagaaaccagattttcatctcgaagataaagtggcgggg
acagaggatttagattattattctcaatttgctacagaggataaattaccagaagaaaag
gttgtccaatacgaaacacaagattgggtacaaaaagaaattatggctttaccaccgaag
tatcgatcagctatcattttgaaatatatagaagatctttctttaaaggagattagtaat
attttgaacctacccgttgctacagtgaaaacgaggattcatcgaggtagggaagcatta
aggaaacggctacgagaaacttga

DBGET integrated database retrieval system