KEGG   Bacillus cellulosilyticus: Bcell_0169Help
Entry
Bcell_0169        CDS       T01389                                 

Definition
(GenBank) putative transmembrane anti-sigma factor
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: zf-HC2 Bactofilin DUF3379
Motif
Other DBs
NCBI-ProteinID: ADU28458
UniProt: E6TTB8
Position
186790..187422
Genome map
AA seq 210 aa AA seqDB search
MACKKDYAEQIHHYLDEELTLLERKRFESHIQKCSACHAHVRELRKTEAIVQSASHIKAP
ANFTDNVMSQLPKQSQKARYKNWMRKHPYIITAATFFLVFIVSLTSIWNDGGKEISVKGD
GHFIVDEERGVVIIPEGETISGDITVRNGNIEINGEVLGNITVINGEQYLASAGSVAGEI
QEINQVLEWMWFHTKSFFSEVLNVMNGDKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atggcttgtaaaaaagattatgcagaacaaatacaccattatttagatgaagagcttaca
ctgttagagagaaaaaggtttgaaagccatatacaaaaatgtagtgcttgtcatgctcat
gttagggaacttaggaagacggaggcaattgtacaaagtgcctctcatataaaggcgcca
gcaaattttactgataatgtcatgagtcagttgccaaagcaatcgcagaaagcacgctat
aaaaactggatgagaaagcacccatatattattactgctgctactttctttttagtattt
attgtgagcttaacttctatttggaatgacggcggaaaagaaatttctgtaaaaggcgat
ggtcacttcatagtagatgaggagcgaggtgtcgttattattcctgaaggagaaactatt
tctggagatattactgtccgtaatggaaatatagaaataaatggagaagtgctaggtaat
ataactgtaattaatggagagcaatatttagcctcagctggtagtgttgctggtgagata
caagaaataaatcaagtgctagagtggatgtggttccatacaaagtcctttttctctgaa
gtactaaatgttatgaatggtgataaacagtaa

DBGET integrated database retrieval system