KEGG   Bacillus cellulosilyticus: Bcell_0170Help
Entry
Bcell_0170        CDS       T01389                                 

Definition
(GenBank) protein of unknown function DUF147
  KO
K18672  
diadenylate cyclase [EC:2.7.7.85]
Organism
bco  Bacillus cellulosilyticus
Brite
Enzymes [BR:bco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.85  diadenylate cyclase
     Bcell_0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
187566..188396
Genome map
AA seq 276 aa AA seqDB search
MLGSIFENISLLDLLVVVIDILLVAYVIYKLINVIRGTRAVQLLKGITVILVVWFLSRQF
GFITLEWIMQQAVVYGLLAIIIIFQPELRRALEQIGRGRFFSKGSTAEEEDVKKNIEHIV
KAANYMGKRRIGALISIEKETGMNDYVETGITMNAHLTSELLINVFIPNTPLHDGAVIIK
NNEIMAAGCYLPLSENPFISKELGTRHRAALGVSEVTDSVTLVVSEETGGISVTKNGELH
RNLDEDALRTLLENDLLNVDQTKSTSRWQWGGKKNG
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgttaggaagtatttttgaaaatatctcattattagatttactagttgttgtcattgat
atattattagtggcttatgttatatacaaattaattaatgtaatacgaggcactagggca
gtccagcttctgaaagggataactgtaatcttagtggtctggtttttaagtaggcaattt
ggatttataacacttgagtggattatgcaacaagctgtcgtctatggtctacttgcaatt
attattatattccagcctgagcttagacgagcactagaacaaattggtagaggtcgtttt
ttttcaaaaggctccacagctgaagaggaagatgttaagaaaaatatagagcatattgtg
aaagctgcaaattacatggggaagcgtcgaattggtgctttaatctcgatcgaaaaggaa
acgggaatgaacgactatgttgagactgggataacgatgaacgctcacctcacttcagag
ctattaatcaatgtatttattccaaacactccgcttcacgatggtgctgtcattattaag
aataatgaaattatggctgcaggatgctatttacctttgtcagaaaatccttttatatca
aaagaattaggaacgcggcaccgcgccgctttaggtgttagtgaagtaacagatagtgtt
acgttagttgtgtctgaggaaactggtggtatttctgttacgaaaaatggagaattacat
cgcaacttagatgaggatgcgttaagaacgttactcgaaaatgatttactaaacgtagat
caaacgaagtctacttctcgctggcagtggggaggtaagaaaaatggataa

DBGET integrated database retrieval system