KEGG   Bacillus cellulosilyticus: Bcell_0171Help
Entry
Bcell_0171        CDS       T01389                                 

Definition
(GenBank) YbbR family protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
188389..189708
Genome map
AA seq 439 aa AA seqDB search
MDKWFNNSWVLKGVSLLIAMMLFLVVNMDRQPTQTGGLPGITNGQRVIEELDLTVYYDED
THVVTEAPEHVQVTLRGPQNILTLLALERQSYEVFVDVRGKEPGVHYERVQHRDFHKDLN
VSINPPTVRITIQEKQTVSLPVEVDIINEGEVGEGYSIGTPTVSPSNVDITAAQGVIEQI
ASVRAVVDVAGRDATFQSATSVIVLDQNGNEMNVNTDPPAVEVTVPITAPNKEVPVRIER
EGELPEGIAVESITAEPSTITVFGPVSIINDISFIDGVKVDLSNITESTSFEVDVQAPNG
VERIAPETITITIEVTQEEEREFSNFEIDVVGVPEGNNYAFIEPEEGMLDISILGSRNVL
DRVSRTDIQLYVDLNDLSDGEHDVPLQFNGPQGVRIDPNIMNSVRLVIYDEDEEPFVEEP
VQGENTSEEIEGEQEENTT
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atggataaatggtttaataattcgtgggtgttaaaaggcgtgtccctccttatagccatg
atgctatttttagttgtaaatatggataggcaaccaacccaaacaggtggattacctgga
attacaaatgggcagcgtgtaatagaggaactagacctaactgtttattatgatgaggat
acgcatgttgtgacagaggcaccagaacatgttcaagtaacattaagaggtccacaaaat
attttaacgcttttagctctagaaagacaaagctacgaagtatttgttgatgttagaggg
aaggaacctggagtacattatgagcgagtgcagcatagagattttcataaagatttaaat
gtttctattaatcctcccacagtacggattacaatccaagagaagcaaaccgtttcactt
ccagttgaagttgatattatcaacgagggtgaagtaggagagggttatagcataggtacg
ccgactgtttctccatctaatgtagatattaccgcggcgcaaggcgttattgagcaaatc
gcaagtgttcgggcggtagtcgatgtagctggaagagatgcgacgttccaatctgcaacg
agtgttatagtgctagatcaaaatggtaatgaaatgaatgttaatactgacccacctgct
gttgaggtaactgtaccaataactgcgccaaataaagaagtacctgtgcgaattgagaga
gaaggtgagttaccggaaggaattgcggttgagtcgataacagcagagccaagcactatt
accgtatttggtccagtttctatcataaacgacatttcgtttattgatggtgtaaaagtt
gatctaagtaatatcactgaaagtacatcttttgaagttgatgtacaagcaccaaatggt
gtggaacgtattgcgcctgaaacgattacaataaccattgaagtgacgcaagaagaagag
agagagttttctaactttgagattgatgtagtaggggttcccgaaggtaacaattatgcg
tttatcgaaccagaagaaggcatgctagatatctccattttgggcagtagaaatgtttta
gacagagtgagtcgaaccgatatacagttatacgttgacttaaacgatttatctgatgga
gagcacgatgttccgttacagttcaatggtccacaaggtgttagaattgatcctaatatc
atgaatagtgttcgtctcgtcatctatgatgaggatgaagagccattcgtcgaggaacct
gttcaaggggaaaatacgagtgaagaaatagaaggagaacaagaagaaaacacaacatag

DBGET integrated database retrieval system