KEGG   Bacillus cellulosilyticus: Bcell_0182Help
Entry
Bcell_0182        CDS       T01389                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
bco  Bacillus cellulosilyticus
Pathway
bco03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:bco00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    Bcell_0182
Enzymes [BR:bco01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Bcell_0182
DNA repair and recombination proteins [BR:bco03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Bcell_0182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADU28471
UniProt: E6TTD1
Position
202023..202925
Genome map
AA seq 300 aa AA seqDB search
MLFTPVKPMLLTMGKEPTNHPEHLYDIKWDGWRILIHKQGNRIEAYTRHGNQVTNQFPEL
QEALSHINKHTAILDCEGVVLRNGNSVFEDFAYRGRLKSTEKIRKAMITHPVTFVAFDIL
ATDKPLLKETLIKRKQYLKDIITPSNVLLATPYVIEDGQTLHTLTKEKGMEGIVEKPLNS
LYHLDTRSPNWLKHKHFKRLDTVIMGYKENPFTMIVGSTFSNGKLKPVAQVEFGFNPEDK
QAFRGIANRLITKEENGVFWLEPLLCCSTQYLEKTSKNMLRITSFKGFLPEKKVEECVFT
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgctgtttacacccgtaaaacccatgcttctaacgatggggaaagaaccgacaaatcac
cctgaacatctttacgatataaagtgggatggttggcgtattctaattcataaacaaggc
aatagaatcgaagcctacactagacatgggaaccaggtaacgaaccaatttccagagcta
caggaagctctctctcatataaacaaacacaccgctatcctcgattgtgaaggagtcgtt
ctacgaaatggaaattccgtttttgaggattttgcttatcgaggtcgcttaaaaagtaca
gaaaagatcagaaaagcaatgatcacacatcccgttacatttgtagcatttgacatatta
gcaacggataagcctcttcttaaagagacactgataaagagaaaacaatatttaaaagac
attattactccatccaatgtattacttgcaacgccttatgttattgaagatggacaaacc
cttcatacattaacaaaagagaaggggatggaagggatagtagaaaaacccctgaattcg
ctgtatcatctggatactagaagcccaaattggcttaaacataagcattttaaacggtta
gatactgttattatgggatacaaagagaatccatttacgatgattgtaggctctaccttt
tcgaacggcaaattaaagccagtggctcaagttgaatttggatttaacccagaagataaa
caggcgttccgaggaattgctaaccgcctcataacaaaagaggaaaatggagttttttgg
ctagaaccgttattgtgttgttctacacagtatttagagaaaacaagtaagaatatgttg
cggatcacctcatttaaggggttcttaccagaaaagaaagtagaagagtgtgtctttacg
taa

DBGET integrated database retrieval system