KEGG   Bacillus cellulosilyticus: Bcell_0183Help
Entry
Bcell_0183        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
204625..205002
Genome map
AA seq 125 aa AA seqDB search
MENNQSISNTQKMCVAYGLLYEVETTLVEIIEKTLRKKYGLEWPIVLKVRRPLETSRYYE
IVGCYVKYEPLKSVFTKEEQQLLFSLDVTRNKIAHMKVITDSEMSKLEEAHLVIGSRKIN
TTIAY
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatcaaagtattagtaatactcaaaaaatgtgtgtggcatatggtttattg
tatgaagtagaaacgaccttagtagaaataatagaaaaaacactgaggaaaaagtatgga
ttagaatggccaattgtattaaaagtccggagacctttggaaacgtcaagatactatgaa
attgttggatgttatgtaaaatatgaacccttaaagagtgtattcacaaaagaggaacaa
caattactattttcgttagatgtaactcgcaataaaatagcacatatgaaagtgataact
gatagtgaaatgagtaaattagaagaagctcatttagttattggatcacgaaaaattaac
acaacaattgcatattga

DBGET integrated database retrieval system