KEGG   Bacillus cellulosilyticus: Bcell_0185Help
Entry
Bcell_0185        CDS       T01389                                 

Definition
(GenBank) Bile acid:sodium symporter
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
205824..206777
Genome map
AA seq 317 aa AA seqDB search
MSLFEKLYTLIILLAVVIGIGIGQMDLIRVNAESFIVPLLVAMLYITFLQIPIEEIKKAF
KNIKFTYTSVTINFVWTPILAWVLAMIFLGDNPALYIGFIMLMVTPCTDWYLIFTGIAKG
NVALSTAILPLNLILQVILLPIYLLIFGGTTGVIELGFLVESILIVLFIPLVLALITKLL
LRNKQQLRESFISKLSVYPTIFLSLAIIAMFASQGQLLLDNLDLIWQITLPLLLFFVINF
IFSQKVGRVMKYSYSDRTSLSLNTLARNSPIALAIAMTAFPDQPLIALVLVIGPLLELPV
LAVITQLLLFFNKNKSQ
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgagcttattcgaaaaattatatacacttattatacttttagcagttgtaattggtata
ggcataggacaaatggacctaataagagttaatgcagaaagttttattgttcctttatta
gtagctatgttatatattaccttcttacaaattcctatcgaggaaatcaaaaaagccttt
aaaaacatcaaatttacatacacttcagtcaccataaattttgtctggacaccaatttta
gcatgggtgctagcaatgatatttctaggagacaatccagccttatatattggatttatt
atgctgatggtcacaccgtgtacggattggtacttaatcttcacaggtattgcaaaagga
aatgttgcactatcaacggctattttacctttgaatctaatcttgcaagtcatattgttg
cctatttatcttctgatttttggaggaaccactggagttattgaactggggtttctagta
gaaagtattttaattgttttattcatacctttggtcttagcacttataacaaaattactt
ttgagaaacaagcaacaattaagagaaagtttcatttctaaacttagcgtgtacccaact
atattcctaagccttgcaattatagctatgttcgcttcccaaggacaattattgcttgat
aatctagatttaatatggcaaataacactccctctccttttgttttttgttataaatttt
atctttagtcaaaaggtaggtcgggttatgaaatattcgtattcagacagaaccagttta
agtttgaatactttagcaagaaactcacctattgctttggcaatagctatgacagcattt
ccagaccagcccctgattgccttagtattagttataggtccattattggaactacctgtt
ttagccgtaattactcaacttttattattttttaataaaaacaagagtcagtaa

DBGET integrated database retrieval system