KEGG   Bacillus cellulosilyticus: Bcell_0189Help
Entry
Bcell_0189        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
210724..211437
Genome map
AA seq 237 aa AA seqDB search
MINLHNDIVKAIVNILVMDDPEARLLYLQSINNVSGEGTQNSSPKQKWDYRYNSLIEMAK
KYELRYFKLDRGKLWEAVLIAGPQNELYVFFSHKNMKNVIKKGKNNHYLKLLNLFNHELD
ELKPIYSQMTLPISFEDDDDSSEDLIEQAREMLSMMEEEPSKVYVFAFDHSFVTTVKAFA
YNTRQEVVWERDLTELIEPNYRLVLTDDEIYPDTRISNNTPETKKEKKQIVSLKNIK
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgattaatctacataatgacattgttaaagctattgttaatatcctcgtaatggacgat
ccagaagcacgtctattatacctacaatctattaataatgtctccggggagggtacccaa
aatagcagcccgaaacaaaagtgggattataggtataactctttaatagaaatggcaaaa
aagtatgaattaaggtattttaagttagacagaggaaagttgtgggaagcggttttaata
gcaggacctcaaaatgaactatatgttttcttcagtcacaaaaatatgaagaacgttata
aaaaagggtaagaataaccattatttaaaattgcttaatttattcaatcatgaacttgat
gagttgaaacctatttattcacaaatgacacttcctatttcctttgaggatgatgatgac
agttcggaagacttaatagagcaagcaagggaaatgctatctatgatggaagaagaacct
tcaaaagtatatgtatttgcatttgatcattcgtttgtaacaactgtaaaagcatttgcc
tataatactaggcaggaagttgtatgggaaagagacttaactgaacttatcgagcctaat
tatagattggtactgacagatgatgaaatctatccagatacgagaatcagtaataatact
ccagagaccaaaaaggagaaaaaacaaattgttagtttgaaaaatataaagtaa

DBGET integrated database retrieval system