KEGG   Bacillus cellulosilyticus: Bcell_0193Help
Entry
Bcell_0193        CDS       T01389                                 

Definition
(GenBank) Excinuclease ABC C subunit domain protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
213783..214574
Genome map
AA seq 263 aa AA seqDB search
MIDMLTEDELRWIEMILEDHDPLEISPSYYHKRKIELEWLNNKGRVRKELDELRKKLKVT
PQQLLELKNDSARREQEIENFPGIYIIHNCVKDIYYIGQSKRVLDRAYKHFVTNPEDMKG
RYELSVKCNLPEIYIDFNSGDKFIVSLIPLDNTSFSSLNELEGYAIVAYDSVVPNGYNRV
IGNIMDKHVFKNDDYEKAANFIFERIIEVKGEDFFLTLSNERKRVVYTHKLFAELRLPRN
LHFSKGFRMMIKEYIKENKKRKN
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgattgatatgttaacagaagacgaactaagatggatagaaatgattttagaggatcat
gaccctttggagatatcaccatcgtattatcataaaagaaaaattgagttggagtggtta
aataataaaggaagagttaggaaagaattagatgaactaagaaaaaagttaaaggtgact
ccacaacagttattggaattaaaaaatgatagtgcaagacgagaacaggagattgaaaac
ttccctggtatatatatcatacataattgtgtaaaggatatatattatatcgggcaatca
aaaagggttcttgacagagcttataaacattttgttaccaacccagaagacatgaaggga
aggtatgaactaagtgttaaatgcaaccttccggagatatatattgactttaattcaggg
gataaattcattgtaagtttgatacctttagataatacatcattttcatcgttaaacgag
ttagaaggctatgctatagttgcttatgattcagtagttccgaatggttacaatagagtt
ataggtaatataatggataagcatgtattcaaaaacgatgattatgaaaaggcggctaac
tttatctttgaaagaataattgaagtaaaaggggaagattttttcttgaccctatcaaat
gaacgcaagagagtagtttacacgcataaattatttgcagaacttcgattacctagaaat
ctccacttctctaaaggttttcgtatgatgattaaagagtatattaaagaaaataagaaa
agaaagaattaa

DBGET integrated database retrieval system