KEGG   Bacillus cellulosilyticus: Bcell_0195Help
Entry
Bcell_0195        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
215693..215794
Genome map
AA seq 33 aa AA seqDB search
MEQTGILQDFAQEIFDKSKFQRPQLQCLETVLS
NT seq 102 nt NT seq  +upstreamnt  +downstreamnt
atggagcaaacgggtattttacaggattttgctcaagaaatatttgataagtcaaagttt
caacgcccccaattacagtgtcttgaaacagtactttcttag

DBGET integrated database retrieval system