KEGG   Bacillus cellulosilyticus: Bcell_0199Help
Entry
Bcell_0199        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
218659..218853
Genome map
AA seq 64 aa AA seqDB search
MLCDCGGVLVVIAIEDIPKHLSSKEKIMYNRVCDVQCQKCDKIQYSQPYDDGNLLNLVKE
TKKI
NT seq 195 nt NT seq  +upstreamnt  +downstreamnt
atgctttgcgattgtggaggagtattagtagttattgcaatagaggacatccccaaacac
ttatcaagtaaagaaaaaattatgtacaatcgagtttgtgatgttcagtgtcaaaagtgt
gataaaattcaatattcacagccgtatgatgatggaaatttgctaaatttagtaaaagaa
acaaagaaaatctaa

DBGET integrated database retrieval system