KEGG   Bacillus cellulosilyticus: Bcell_0201Help
Entry
Bcell_0201        CDS       T01389                                 

Definition
(GenBank) Restriction endonuclease, type II, AlwI
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
219441..221036
Genome map
AA seq 531 aa AA seqDB search
MRKVWFITRPERDPKFHVDALRALQIATDNFTVIWLGNRDAHKHYEAVLGSEELKRDNIS
NDGSGGRTWAAMLRTFGYVYLNSDGYLVLTKVGQKVLNSEKVRENISKQILTLQIPNAYF
LDSGFRPKYEEDFQIRPARFLVRLVNQSILDYYVTKEEITFFALTAKRDDEIFNVTKRIL
DFRKASDTEKSQIKKSVATHFDHRQRADSDARDFASAHGDVAHTFMMLCDYTGFVDYVRG
DALRLPTDKQNTTSEMLNYMENRYPFNKRYLISLERFAENAGLDIDSYKASAFGSLPPAT
NRGKSVKKVQRLLAAYPLVQGLTVEQIVEILEQELSTNEAKKFANELHNQNYESLNDDFV
EAYLYEENDRVFEDKTGEILRSIGFNVEMRPKPLGNDVRTEIEILIHVDEETVCILDAKN
YREKFTLSANLASHMASEYIPNYHGYEGKSVAYFGYVTANRFGGERHLEKICEKAKLINS
EIQVSGVILSAKALLGFLDYCLEHELTKEERKERFISLFNNTGYENVGEMF
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
gtgcgaaaagtttggtttattactcgacctgaacgtgatccaaaatttcatgtcgatgca
ctcagggcacttcaaattgcaaccgataattttactgttatttggttggggaacagagat
gctcataagcattatgaagcggtcttaggttctgaagagctaaagagggataatatcagt
aatgatggatctgggggtagaacatgggcagctatgttgcgaacatttggctatgtttat
ttgaattcagacggttacttagttctaacaaaagttggacaaaaggttttgaattctgaa
aaagtaagggagaatatttcaaagcagattctaaccttgcaaattccaaatgcgtatttt
ttggatagtggctttaggccgaaatacgaagaggattttcaaataaggccagcaagattt
cttgtgcgattggtgaatcaatcaatacttgactactatgtgactaaggaagaaataact
ttcttcgctcttacagcaaaacgggatgacgagatttttaacgttacaaaaagaatattg
gacttcaggaaggcttctgacactgaaaaaagtcaaataaaaaagtctgtagctacccat
tttgaccataggcaaagagcagacagtgatgctcgtgactttgcatccgcacacggagat
gtagcccatacttttatgatgctatgcgattacacaggatttgttgattatgtcagaggg
gatgctttacgattaccaacggataagcaaaatactacttctgaaatgctgaattacatg
gagaataggtatccttttaacaaaaggtatttgatttcgcttgaaagattcgctgaaaat
gcaggtttagatatagacagttataaggcaagtgcatttggttcactacctccggctact
aatagaggaaaaagtgtaaaaaaagtccagcgtcttttagcagcatacccattagttcaa
gggttaactgtagaacaaattgttgaaattttagaacaagaactttctacaaatgaggca
aagaaatttgctaatgagctacacaatcaaaactacgaatccttaaatgatgattttgtt
gaagcatatctttatgaggaaaatgatcgtgtcttcgaggataaaacaggtgaaatttta
aggtccataggttttaatgtggaaatgcgaccgaagccattaggaaatgatgttaggact
gagatagaaattttaatacatgttgacgaggaaactgtttgtattctagatgctaaaaat
tacagagagaaattcacactatctgcaaatttagcgtcacatatggcttcggagtatatt
cccaattaccatggctatgaaggtaaatcagttgcttattttggttatgttaccgcaaac
aggtttggtggtgaacgccatctcgaaaaaatatgtgaaaaggcaaaattgataaattct
gaaattcaagtgtctggtgtaatcttatctgcaaaggctttattaggatttttagattat
tgcttggagcatgaattaaccaaagaagaacgaaaagaaagatttatatctttgtttaac
aacactgggtatgaaaatgtaggagaaatgttttag

DBGET integrated database retrieval system