KEGG   Bacillus cellulosilyticus: Bcell_0202Help
Entry
Bcell_0202        CDS       T01389                                 

Definition
(GenBank) DNA-cytosine methyltransferase
  KO
K00558  
DNA (cytosine-5)-methyltransferase 1 [EC:2.1.1.37]
Organism
bco  Bacillus cellulosilyticus
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bco00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Bcell_0202
Enzymes [BR:bco01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     Bcell_0202
DNA replication proteins [BR:bco03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   DNA methylation enzymes
    Bcell_0202
Chromosome [BR:bco03036]
 Eukaryotic Type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Bcell_0202
Prokaryotic defense system [BR:bco02048]
 Restriction and modification system (R-M system)
  Type II R-M system
   DNA methyltransferases
    Bcell_0202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
221200..222348
Genome map
AA seq 382 aa AA seqDB search
MIFRKGELFNGPGGLALGAKNAGFIHPETGEEWKIQHVWSNDYDSNACKTYGYNICGDEN
DESVHIGPVENLPIGNKDVIGDIDCFAFGFPCNDYSQVGEKKGLNGTFGPLYSYGIKVLR
LYQPKFFIAENVGGLQSANEGQAFVKILSELEEVGYKLTPHLYRFEEYGVPQARHRIIIV
GIRNDLAKEGIEFKVPAPTTLASTEYKTSRQAILEPPIPEDAPNHEMPRHTKKVQEMLSY
IPAGENAWYLGIPEELRLNVKGARLSSIYKRLDPNRPAYTVTGSGGGGTHMYHWSENRAL
TNRERARLQTFPDDFMFFGSKEAIRKQIGMAVPPEGAKIVFNAVLKTFAGIEYDSIPPIE
KLQLENLRGTKKESVKELVTSL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgatttttcgtaagggagagttatttaacggaccgggaggactagccctaggagcaaaa
aatgctggttttattcacccggaaactggtgaagaatggaaaattcagcatgtgtggtca
aatgattatgatagcaacgcatgtaaaacatatggatataatatctgtggtgatgaaaat
gatgagtcggttcatataggaccagttgagaatctaccaataggcaataaagacgtaata
ggagatattgattgctttgcattcggttttccttgcaacgattactcccaggttggagag
aaaaagggcttaaatggtactttcggacccttgtattcctatggaattaaggtattgaga
ttataccagcctaaattttttatagctgaaaacgtgggtggactccagtctgctaatgaa
ggtcaggcattcgtaaaaattttatcggaattagaggaagtgggttacaaattaacacca
cacttatataggtttgaagaatatggtgttccacaagcacggcatagaattattatcgtg
ggaattcgaaatgacttagcaaaagaagggattgaatttaaagttcctgcaccaaccact
ttagcatcaacagagtataaaacttctcgacaagctattttggagcctccaattcctgaa
gatgcaccaaatcatgaaatgccaagacatacaaaaaaggttcaagagatgttaagttat
attccagctggggagaatgcttggtatcttggtattcctgaagaactacgcctgaatgtg
aaaggggcacggctaagttcgatctataaaagattagatcctaatcgacctgcctatacc
gttacaggaagcggtggtggtggtactcatatgtaccattggagcgagaatagagcctta
acaaaccgtgaaagagctagacttcaaacatttcctgatgattttatgttttttgggagt
aaggaagctattagaaaacaaatcggaatggcagttccacctgaaggagcaaaaattgta
tttaatgcggtactaaaaacttttgctggaatagagtatgattcaattccaccaattgaa
aaattacaattagaaaacctaagaggtacaaagaaagagtctgttaaggagttagttacc
tcactataa

DBGET integrated database retrieval system