KEGG   Bacillus cellulosilyticus: Bcell_0209Help
Entry
Bcell_0209        CDS       T01389                                 

Definition
(GenBank) hypothetical protein
Organism
bco  Bacillus cellulosilyticus
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
228581..229123
Genome map
AA seq 180 aa AA seqDB search
MQSTRVMAAELLREKIELAKTTLKFVEIVESGSGEGFEPEYNKSRHPFHNEDGTPLLGIR
VYKEPITYEELNVGKGSIVALTEIYLTDRGDLVRFCTFEETFYSSKNEKPRIQMKSFISG
DQLIADDELHFILFHTTWLISHHYVIQGNHEKAAIAIEENRRIYDIVYEWLERTVRDKKD
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctacaagagtaatggcagccgaactattaagagagaaaattgaactagccaaa
acgactttgaaatttgtggaaatagtagagtctggatctggagagggctttgaaccagaa
tataacaaatcacggcatccttttcataacgaggatgggactccattgcttggaataagg
gtctataaggaaccgattacttatgaggaactaaacgtaggtaaaggttcaattgtagct
ttgaccgaaatttaccttacagacagaggtgatctggttcgattctgcacatttgaagaa
acgttctacagttccaaaaatgaaaaacctagaattcagatgaaaagtttcatttctgga
gaccagttaattgctgatgatgaattacacttcatccttttccatactacctggctcata
agccatcattatgttattcaaggaaatcacgaaaaagcggctatagcaatcgaagagaat
agaagaatatatgacattgtttatgagtggttggaaagaaccgtcagagataaaaaagac
taa

DBGET integrated database retrieval system